KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_1269Help
Entry
APJL_1269         CDS       T00644                                 

Gene name
pstB
Definition
(GenBank) phosphate transport ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
apj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:apj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    APJL_1269 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:apj02000]
    APJL_1269 (pstB)
Enzymes [BR:apj01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     APJL_1269 (pstB)
Transporters [BR:apj02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    APJL_1269 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_22 RsgA_GTPase AAA_29 AAA_23 AAA_16 Rad17 AAA_30 G-alpha AAA_28 AAA_18 AAA_33 AAA_5 RNA_helicase PRK AAA_7 AAA_25 NACHT AAA_14 MMR_HSR1 Mg_chelatase Ploopntkinase3
Motif
Other DBs
NCBI-ProteinID: ABY69825
UniProt: B0BQJ0
LinkDB All DBs
Position
complement(1396800..1397579)
Genome map
AA seq 259 aa AA seqDB search
MSNELISLQDTKIAINNLDFFYGDFHALKNINLRIAKNKVTAFIGPSGCGKSTLLRTLNR
MYEQYPNQSAQGEILFEGENLLTTETDIALIRAKIGMVFQKPTPFPMSIYDNVAFGIRLF
EKLPKSELNDRVEWALTKAALWNEVKDKLNQSGDSLSGGQQQRLCIARGIAVKPEVLLLD
EPCSALDPISTMKIEELISELKHDYTVAIVTHNMLQAARCSDYTAYMYLGELVEFGETKQ
IFDKPKFQRTEDYIRGRMG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacgaattaatttcactacaagacactaaaatcgccatcaataacttagacttt
ttctacggtgattttcatgccttaaaaaatatcaatttgcgcattgcgaaaaataaagtt
accgcatttatcggcccttccggctgcggtaaatcaactttattacgtaccttaaaccga
atgtatgaacaatatccgaaccaaagtgcgcaaggggaaatcctgtttgaaggtgaaaac
ttattaacgaccgaaaccgatattgccttaatccgtgccaaaatcggtatggttttccaa
aaaccgactccgttcccgatgtcaatttatgataatgtagcgtttggtatccgtttattt
gaaaagttaccgaaatcggaattaaatgatcgtgtcgaatgggcattaaccaaagccgca
ttgtggaacgaagtgaaagataaattaaatcaaagcggcgacagtttatccggcggtcag
caacagcgtttatgtattgcacgcggtattgcggtaaaaccggaagtgttattgttagac
gaaccctgttcggcgctcgacccgatttcaaccatgaaaatagaagaattgatcagcgag
ttgaaacacgattatacggtggcgattgtgacccataatatgctacaggcggctcgttgc
tcggattacaccgcttatatgtatttaggcgaattagtcgaatttggtgaaaccaaacaa
attttcgataaaccgaaattccaacgtaccgaagattacattcgaggtagaatgggttaa

DBGET integrated database retrieval system