KEGG   Acetobacter pasteurianus 386B: APA386B_2736Help
Entry
APA386B_2736      CDS       T02786                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
apk  Acetobacter pasteurianus 386B
Pathway
apk00010  Glycolysis / Gluconeogenesis
apk00020  Citrate cycle (TCA cycle)
apk00620  Pyruvate metabolism
apk01100  Metabolic pathways
apk01110  Biosynthesis of secondary metabolites
apk01120  Microbial metabolism in diverse environments
apk01130  Biosynthesis of antibiotics
apk01200  Carbon metabolism
Module
apk_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:apk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APA386B_2736 (pdhC)
   00020 Citrate cycle (TCA cycle)
    APA386B_2736 (pdhC)
   00620 Pyruvate metabolism
    APA386B_2736 (pdhC)
Enzymes [BR:apk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     APA386B_2736 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N
Motif
Other DBs
NCBI-ProteinID: CCT60768
UniProt: S6D6E8
LinkDB All DBs
Position
complement(2799498..2800742)
Genome map
AA seq 414 aa AA seqDB search
MATEILMPALSPTMTEGKLARWLKKEGDTVNSGDVLAEIETDKATMEVEAIEEGILGRIL
IQEGAEGVAVNTPIAILVEEGEAVPDNIDTPKNVASAEPAPVPQPVASAPVAAQAAPAQR
ADKPVGRVVASPLARRIARQKNIDLAAIKGTGPNGRIVKRDVEAALNKAPSAGQVASALP
ASGGSSAVPHTTMRKVIARRLSESKATIPHFYVSIDVELDALLALRAQLNAMSPAEGADA
FKLSVNDMLIKASAVALKQVPEVNASYTEDAMILHEDADISVAVSLDDGLITPIVKQADR
KSLKDISQEAKDLIARARAGKLKPEEFQGGTFSISNMGMYGVKDFAAIVNPPQAAILAIA
AGKKQAVVKGNELAIATVMTVTLSVDHRVVDGAAAARWLSAFRTAVESPLSLVL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgaaattttaatgcccgccctttctcctaccatgacagagggcaaactggcc
cgctggctgaaaaaggaaggggacaccgtaaacagcggtgatgttctggccgagattgaa
accgacaaagccacaatggaagtagaagccattgaggaaggtattctgggccgcatcctt
attcaggaaggcgcagaaggtgttgctgtcaacacacctatcgccattctggtggaagaa
ggtgaggcggtgccagataacatcgacacgcctaaaaacgtggcgtctgctgagccagcc
cctgtgccgcaacctgttgcttctgcaccagtagcagcacaggccgcacctgcacagcgg
gcagataagcctgttggccgggttgtggcctctccacttgcgcggcgcattgcacgccag
aagaatattgatctggcagccattaaaggcactggcccaaatggccgtattgttaaacgg
gatgtggaagccgctcttaacaaagccccaagtgcagggcaggtggcttctgccttgcca
gcatctggtggcagcagtgcggtgccgcacaccactatgcgtaaggttattgcacgccgc
ctgagtgaatccaaagccaccattccgcacttctatgtctccatagatgtagaactggat
gcactactggctttgcgtgcgcagcttaatgccatgtctcccgcagaaggggctgatgcc
ttcaagctgtctgtaaacgatatgctcattaaggcttctgccgttgcccttaagcaggtg
ccggaagtgaacgcgtcttacaccgaagatgccatgatcctgcacgaagatgcagatatc
tcggttgcggtttctctggatgatgggctgatcacgcctatcgtcaaacaggcagaccgc
aagagcctgaaagatatcagtcaggaagccaaggatctgattgcccgcgcccgcgctggc
aagctgaagccggaagaattccagggtggtacgttctccatttccaatatggggatgtac
ggcgtgaaagactttgccgccattgttaacccgccgcaggctgccattctggctattgca
gcaggtaaaaaacaggctgtggtaaaagggaatgaactggctattgctacagtcatgacc
gttaccctctcggtggatcaccgtgtggtggatggtgcggcggctgcgcgttggctttct
gctttccgtacagcggttgaatctccgctttcactcgttctctaa

DBGET integrated database retrieval system