KEGG   Acetobacter pasteurianus 386B: APA386B_806Help
Entry
APA386B_806       CDS       T02786                                 

Gene name
ddl
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
apk  Acetobacter pasteurianus 386B
Pathway
apk00473  D-Alanine metabolism
apk00550  Peptidoglycan biosynthesis
apk01100  Metabolic pathways
apk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:apk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    APA386B_806 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    APA386B_806 (ddl)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    APA386B_806 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:apk01011]
    APA386B_806 (ddl)
Enzymes [BR:apk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     APA386B_806 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:apk01011]
 Precursor biosynthesis
  Amino acid ligase
   APA386B_806 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 CPSase_L_D2 ATP-grasp_4 B12-binding UPF0180 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: CCT58914
UniProt: S6CWU5
LinkDB All DBs
Position
831632..832570
Genome map
AA seq 312 aa AA seqDB search
MNAPKRVTVLMGGMSSERVVSLSSGQGVAEALRSKGYDVCTLDAQDDLATLVEALNAQKP
DVVFNALHGRFGEDGCIQGILDWMGIPYTHSGIRASATAMDKAAARAIFQTAGLPVAEGM
VVDIATLAHADPLPTPYVVKPLNEGSSVGVSIVRTGSNTRADIVKNWTYGPQALVEAFIP
GREITVGVMGDRALTITDITPTGTGHDFYDYDSKYQVGGSAHVLPAQIDAASAKLALEVA
VKAHQALGCSGASRSDFRLDDTNPDQPHLVLLEVNTQPGMTATSLLPEQAAYCGISYPEL
CAWLVEQATCRQ
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaccaaaacgcgtaaccgtgctgatgggtggcatgtcctccgaacgggtggtc
agcctttcatccggtcaaggcgtggctgaggctctgcgcagcaaagggtatgatgtctgc
acgctggatgctcaagatgatctggctacgttggttgaagcgttaaacgcccaaaaaccg
gatgtggtgtttaacgccctgcatggtcgttttggtgaggatggctgtattcagggcata
ctggactggatgggtatcccctacacccattcgggcattcgggcctctgccactgctatg
gataaagccgctgcccgcgctattttccaaacagccgggctgcccgtggcagaaggcatg
gtggtagatattgccacccttgctcatgcagaccccttgcccacaccttatgtggtgaaa
ccgcttaatgaaggctcatccgttggggtttccattgtgcgtacggggtccaacacgcgc
gctgatattgttaaaaactggacttacggtccgcaggcacttgtagaagcctttattccc
ggccgtgaaattaccgtaggtgttatgggtgatcgggcgctcaccattacggatattacc
cctaccggcaccgggcatgatttttacgactatgattccaaatatcaggtcggcggctct
gcccatgttctgcctgcacaaattgatgccgccagcgccaaacttgctctggaagttgcc
gtaaaagcgcatcaggcattggggtgttctggcgcatcgcgctctgactttcggttggat
gataccaacccggatcagccacaccttgttctgctggaggtcaacacgcagccgggtatg
acggccacatccctgctgcccgaacaggccgcctattgtggtatcagctaccccgaactt
tgcgcgtggttggttgaacaggctacctgccggcaatga

DBGET integrated database retrieval system