KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0076Help
Entry
APL_0076          CDS       T00476                                 

Gene name
tonB2
Definition
(GenBank) protein TonB2
  KO
K03832  periplasmic protein TonB
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Brite
KEGG Orthology (KO) [BR:apl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:apl02000]
    APL_0076 (tonB2)
Transporters [BR:apl02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   APL_0076 (tonB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TonB_C TonB_2 TolA GAGA_bind
Motif
Other DBs
NCBI-ProteinID: ABN73184
UniProt: A3MYE8
LinkDB All DBs
Position
complement(86901..87767)
Genome map
AA seq 288 aa AA seqDB search
MKKKHSRIGLTGSILIHTAIFGGLASMVTHSHSDDLPQEETMSMELVAALLEQPQVAVAQ
EEPAPPEPPEPEKVEVEPEPEPEAEAIPELKPQPKPKEKPKEKPKEKPKPKEPPKPKEKE
KPKKEKVKDKPIKALEKGPEAKQGIVAKAIPNAVQGTQLRAGIPNGKPEGNPNGLSANGS
QNGAVGGSGSGASGSEIGAYKAALQRALQRRANNAYPTREKMMRKTGVVTIGFTVSSSGE
LINVKVLNSSGNGNLDNAAVKAAQSTKVSPPPAGFPSNVTVPVKFSIE
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaacattctcgtatcggtttaaccggctccattcttatccataccgctatt
ttcggcggtttagcctctatggtaacccattctcattccgatgatttaccccaagaagaa
acgatgtctatggagttagtcgccgcacttttggaacaacctcaagttgccgtcgcacaa
gaagagccggcaccgccggagccgccggagccggagaaagtcgaagtcgagccggaaccg
gagcctgaagcggaagctattccagaacttaaacctcagcctaagccgaaagaaaaaccg
aaggaaaagcctaaggaaaaaccaaaaccgaaagagccgccaaagcctaaagaaaaagaa
aaacctaaaaaagagaaagtaaaagataaaccgattaaggcgttagaaaaaggtcctgaa
gcaaaacaaggtattgtcgccaaagcgattcctaatgcggtacaaggcactcaattacgt
gcaggtattccaaacggtaaaccggaaggtaatccgaacggtctttccgccaacggctca
caaaacggtgcggtaggcggtagtggtagcggagcttccggaagtgaaatcggtgcgtat
aaagcggcattacaacgtgcattacaacgccgagccaataacgcttatccgactcgagaa
aaaatgatgcgcaaaacgggcgtggttactatcggttttaccgtatcctcttccggcgag
ttaatcaatgtcaaagtgttaaacagttccggtaacggtaatcttgataatgcggcggtc
aaagcggcacaaagcacgaaagtttcaccgccgccggcgggattcccgagtaatgtgacc
gttccggtaaaattctcgattgaataa

DBGET integrated database retrieval system