KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0194Help
Entry
APL_0194          CDS       T00476                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase (SK)
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
apl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
apl01100  Metabolic pathways
apl01110  Biosynthesis of secondary metabolites
apl01130  Biosynthesis of antibiotics
apl01230  Biosynthesis of amino acids
Module
apl_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:apl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    APL_0194 (aroK)
Enzymes [BR:apl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     APL_0194 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Cytidylate_kin2 AAA_33 Cytidylate_kin dNK AAA AAA_17 Thymidylate_kin TsaE CoaE AAA_5 AAA_22 ABC_tran AAA_16 AAA_28 AAA_23 AAA_24 Mg_chelatase AAA_29 APS_kinase AAA_PrkA Ploopntkinase3 Rad17 IstB_IS21 RNA_helicase AAA_7
Motif
Other DBs
NCBI-ProteinID: ABN73302
UniProt: A3MYR6
LinkDB All DBs
Position
complement(213831..214352)
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLIGPMGAGKSTIGRQLAQMLGMEFIDSDAVIEERAGADIDWIFDLEGETGFR
KREERIINELTQNQGVVLSTGGGSVLSKENRNVLSARGIVIYLETTVDKQFERTQRDKKR
PLLQTENPRETLEALAKVRNPLYEEIADITLQTDEQSAKLVATHIIELIDNLQ
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaacgtaatattttccttataggtcctatgggtgcgggtaaaagcaccatt
ggtcgtcagctcgctcaaatgctaggaatggaatttattgattctgacgcagtaattgaa
gaacgtgccggtgcagatatcgattggatttttgaccttgaaggtgaaaccggttttcgt
aagcgtgaagaacgtattattaacgagcttacgcaaaaccaaggtgttgtattatcaacc
ggcggcggttcggtgttatccaaagaaaatcgcaacgtcttgtccgctcgcggtatcgtt
atctaccttgaaactacggtggataaacaattcgagagaacgcaacgcgataaaaaacgt
ccgttgctgcaaacggagaatcctcgtgaaacgctggaagcactggcaaaagtacgcaat
ccgctctatgaagaaattgcggacattacgctacaaaccgatgagcaaagcgctaaactg
gttgcgacacacatcattgaactgattgataatcttcaataa

DBGET integrated database retrieval system