KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0339Help
Entry
APL_0339          CDS       T00476                                 

Gene name
pepC
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
apl00620  Pyruvate metabolism
apl00680  Methane metabolism
apl01100  Metabolic pathways
apl01120  Microbial metabolism in diverse environments
apl01200  Carbon metabolism
Module
apl_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:apl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    APL_0339 (pepC)
  09102 Energy metabolism
   00680 Methane metabolism
    APL_0339 (pepC)
Enzymes [BR:apl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     APL_0339 (pepC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF4754
Motif
Other DBs
NCBI-ProteinID: ABN73443
UniProt: A3MZ57
LinkDB All DBs
Position
complement(373967..376606)
Genome map
AA seq 879 aa AA seqDB search
MNQPYSAMRNNIHMLGDFLGETIREAQGNEILELIESIRVLSRDSRAGDEKAREQLLDKL
ANISTENVLPVARAFSQFLNLTNIAEQYQTISRHHQDESLGNRSLSALFARLKAQGTPVE
TVIKTVEKLSIELVLTAHPTEVTRRSLVHKHVEINKCLGQLEHDDLTEAEQTKLKRRLMQ
LIALAWHTNEIRAARPTPVDEAKWGMAIIENSLWKAVPDFCRELNFQLEKHFDVQYEVAL
SPVRFSSWMGGDRDGNPFVTAEITQKVLRMNRWKAAELFLNDVSDLVEELSIVQCTPEFR
EKYGDHIEPYRVVVKGLRSKLQKTLTYFGELIEAKPTTVDPSEIITCDNDLWEPLYDCYQ
SLHACGMRIIANGSLLDCLRRIRCFGLGLSRLDIRQESSRHETAIAEITRYIGLGDYAQW
TEDDKQAFLVRELSSRRPLVPTNWTPSPETQEILDTCKVVAQQPEGTISAYVISMAREAS
DVLAVHLLLKEAGCNYTLPVAPLFETLDDLDHSEKVMTDLFNIGWYRGVINNYQMVMIGY
SDSAKDAGMLAASWAQYRAQEALVNLAEKYHIELVLFHGRGGTVGRGGAPAHAALLSQPP
RSLKSGLRVTEQGEMIRFKLGLPAVAVETLNLYASAILEANLLPPPEPKQKWRDIMDKGA
AISCEIYRGVVRGEPDFVPYFRSATPEQELGKLPLGSRPSKRNPNGGVESLRAIPWIFAW
MQNRLMLPAWLGAGAALRQMIEQGEESTLKEMCNEWPFFSTRIGMLEMVFSKADLWLAEH
YDQRLVAKELHRLGKTLRAQLSADIQTVLTLAHDGQLMADLPWIAESIALRNVYTDPLNL
LQVELLQRLRSQGEVRDPQLEQALMITITGIAAGMRNTG
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaccctactccgctatgcgtaacaacatccatatgcttggtgattttttaggc
gaaaccattcgagaagcccaaggcaacgaaatattggaattaattgaaagcatccgagta
ctttcaagagattctcgtgcaggcgatgaaaaagcccgtgaacaattactggataaactc
gccaatatttccaccgaaaatgttttacccgttgcacgcgcattcagtcaattcttaaat
ctcaccaatattgccgaacaatatcaaaccatctctcgtcatcatcaggacgaatctctc
ggcaatcgttcattaagtgctttatttgctcgtctaaaagcacaaggcacaccggttgaa
accgtcatcaaaaccgttgagaagttatcaatcgaattagtcttaaccgctcacccgacc
gaagtaactcgccgttcgttagtacataaacacgttgaaatcaataaatgtttagggcaa
ttggaacacgacgatttaaccgaggcggagcaaaccaaacttaaacgccgtttaatgcag
ctgattgcgcttgcatggcataccaatgaaatccgtgcggcacgtccgacgccggtggat
gaagcgaaatggggaatggcgattattgaaaacagcttatggaaagccgtacctgatttt
tgccgtgaactgaactttcaattagaaaaacattttgacgtacagtatgaagtcgcactt
tcgccggtacgcttttcttcttggatgggcggcgaccgtgacggcaacccgtttgtgact
gccgaaatcacacaaaaagtattaagaatgaaccgttggaaagcagcggaattattttta
aacgatgttagcgacttggtcgaagaactttctatcgtacagtgtacgcccgaatttcgt
gagaaatacggcgatcatatcgagccgtatcgcgttgtggttaaaggtttacgtagcaaa
ttacaaaaaactttaacttacttcggcgaattgattgaagcgaaaccgaccactgttgat
ccgagcgaaattatcacttgcgataatgatttatgggaaccgctctatgattgctatcaa
tcgttgcacgcttgcggtatgcgtattatcgctaacggtagtctgttggactgcttacgc
cgtattcgttgcttcggcttaggtttatctcgtttggatattcgtcaagaaagctcccgc
cacgaaacggcaattgccgaaatcactcgctatatcggcttaggcgattacgcacaatgg
acggaagacgataaacaagcgtttttagtgcgtgaactaagttctcgtcgtccgttagta
ccgaccaactggacgccaagtcctgaaacccaagaaattttagacacttgcaaagtggta
gcccaacaacctgaagggacgatttccgcttatgtgatttctatggcacgcgaagcttcc
gacgtattagcggtacatttattattaaaagaagccggttgcaattataccctaccggtc
gcaccgttatttgaaacgttggacgacttggatcatagtgaaaaagtgatgaccgattta
tttaatatcggttggtatcgcggtgtgatcaacaattatcaaatggtgatgatcggttat
tccgattcggctaaagacgccggtatgcttgccgccagctgggcgcaatatcgcgcgcaa
gaagcattggttaatttagcggaaaaatatcatattgaactcgttttattccacgggcgc
ggcggtacggtcggtcgcggcggtgcgccggcacacgcggcattactatcacaaccgcct
cgctcgctaaaatccggtttacgcgtcaccgaacaaggcgagatgatccgcttcaaactc
ggcttacccgctgttgcggtcgaaacgttaaatctctatgcaagtgcgattttagaggcc
aacttattaccgccgccggaaccgaaacaaaagtggcgagatattatggataaaggcgcg
gcaatttcttgtgaaatttatcgcggcgttgttcgcggcgaaccggattttgtcccgtat
ttccgcagtgcgaccccagaacaagaattagggaaattaccgctcggctctcgtccttca
aaacgtaatccgaacggtggtgtggaaagcctacgcgcgattccttggattttcgcttgg
atgcaaaaccgtttgatgttaccggcttggcttggtgccggcgcggcactgcgccaaatg
atcgaacaaggcgaggaaagtacgcttaaagaaatgtgtaacgaatggccgttcttctct
acccgtatcggtatgctggaaatggtgttctcgaaagcggatttatggcttgcggaacat
tacgaccaacgtttggtggcaaaagagttacaccgtttaggtaaaacgcttcgtgcgcaa
ttatcggcggacattcaaacggtattgacacttgcgcacgacggacagcttatggcggat
ttaccttggattgccgaatctatcgccttacgtaacgtctataccgacccgctcaattta
ctgcaagtagaactgctgcaacgtttacgtagccaaggtgaggtaagagatccgcaattg
gaacaagccttaatgatcacaattaccggcattgcggcgggtatgcgtaataccggttag

DBGET integrated database retrieval system