KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0408Help
Entry
APL_0408          CDS       T00476                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
apl00061  Fatty acid biosynthesis
apl00780  Biotin metabolism
apl01100  Metabolic pathways
apl01212  Fatty acid metabolism
Module
apl_M00083  Fatty acid biosynthesis, elongation
apl_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:apl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    APL_0408 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    APL_0408 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:apl01004]
    APL_0408 (fabZ)
Enzymes [BR:apl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     APL_0408 (fabZ)
Lipid biosynthesis proteins [BR:apl01004]
 Fatty acid synthase
  Component type
   APL_0408 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas CDC48_2
Motif
Other DBs
NCBI-ProteinID: ABN73512
UniProt: A3MZC6
LinkDB All DBs
Position
complement(465147..465611)
Genome map
AA seq 154 aa AA seqDB search
MTIEVQENREPKIIEVTEIMKMLPHRYPFLLVDRVIDFEEGKWLKAIKNVTVNEPCFTGH
FPESPIFPGVLILEAMAQATGVLAVATHGKMAQDELYYFAAIDNARFKRPVVPGDQLTFE
VEFLKEMRGITKFTGKAFVDGKLVCEADLMCARK
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgactattgaagtacaagaaaatagagaacctaaaattattgaagtaacggaaattatg
aaaatgttacctcatcgctatcctttcttacttgtagatcgtgttattgattttgaagaa
ggcaaatggctgaaagcaattaaaaacgtgaccgtaaacgaaccttgttttaccggtcac
ttccctgaaagtccgattttccctggcgtacttattttagaagcgatggcgcaagcaacc
ggcgtattagcggtcgcgacacacggaaaaatggcgcaagacgaattatattattttgcg
gctattgataatgctcgctttaagcgtccggtcgtgccgggtgaccaacttacattcgaa
gttgaatttttaaaagaaatgcgtggtatcactaaatttaccggaaaagcttttgttgat
ggaaaactagtgtgcgaagccgatttaatgtgtgcacgtaaataa

DBGET integrated database retrieval system