KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_1446Help
Entry
APL_1446          CDS       T00476                                 

Gene name
afuA
Definition
(GenBank) ABC-type Fe3+ transport system, periplasmic component
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
apl02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:apl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    APL_1446 (afuA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:apl02000]
    APL_1446 (afuA)
Transporters [BR:apl02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Iron(III) transporter
    APL_1446 (afuA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_8 SBP_bac_11 SBP_bac_1
Motif
Other DBs
NCBI-ProteinID: ABN74530
UniProt: A3N294
LinkDB All DBs
Structure
PDB: 

Position
1656814..1657854
Genome map
AA seq 346 aa AA seqDB search
MKFGKLSLAVSTALLGAGLMFSSAAQAKGRLVIYCSATNVMCENAAKTFEQKYDVKTSFI
RNGSGSTFAKIEAEKNNPQADVWYGGTLDPQSQAGELGLLEAYRSPNIDQIMPKFQDPAK
VKGNLSSAVYIGILGFAVNTERLKKLGIEKIPQCWNDLTDPKLKGEIQIADPQSSGTAYT
AIATFAQLWGEDKAFDYFKHLHPNISQYTKSGITPARNAARGETTVGIGFLHDYALEKEQ
GAPLEMVVPCEGTGYELGGVSILKGARNLDNAKLFVDFALSKEGQETAWKKGQALQTLTN
TTAEQSPLAFDLTKLKLIDYDFEKYGASDERKRLINKWVDEIKLAK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttggaaaactttctttagcggtttcaaccgcattacttggtgcgggcttaatg
ttcagttcggcggctcaggcaaaaggacgtttagtgatttactgtagtgcgaccaatgtg
atgtgtgagaatgcggcaaaaacattcgaacaaaaatatgatgtgaaaacgtcttttatc
cgaaacggttccggcagtacctttgcaaaaatcgaagcggaaaaaaataatccgcaagcg
gacgtttggtacggcggtactttagacccgcaatcgcaagcgggtgaattaggcttatta
gaagcgtatcgttcgccgaatatcgatcaaattatgccgaaattccaagatccggcaaaa
gtaaaaggcaatttaagttctgcagtatatatcggtattttaggctttgcggtaaataca
gaacgtttgaaaaaattaggcattgaaaagattccgcaatgctggaacgatttaaccgat
ccgaaattaaaaggtgaaattcaaattgccgacccgcaaagttcaggtacagcctatacc
gctatcgcaactttcgctcaactttggggcgaagataaagcgttcgattacttcaaacat
ctccatccgaatatttctcaatataccaaatcaggtatcacaccggcacgtaatgccgca
cgcggtgaaactacggtcggtatcggtttcttacacgactatgcgttagaaaaagaacag
ggtgctccgcttgaaatggttgtgccgtgcgaaggtaccggctatgaattaggtggtgtg
agtatcttaaaaggtgcgagaaacttagataacgctaaattattcgttgattttgccctt
tctaaagaaggtcaggaaaccgcatggaaaaaaggtcaagcgttacaaacgctaaccaat
accacggctgaacaatctccgcttgcttttgatctgactaaactaaaattaattgattac
gattttgaaaaatacggtgcaagtgacgaacgtaaacgcttaataaataaatgggttgat
gaaataaaattagcgaaataa

DBGET integrated database retrieval system