KEGG   Anas platyrhynchos (mallard): 101790010
Entry
101790010         CDS       T02816                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla04068  FoxO signaling pathway
apla04217  Necroptosis
apla04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:apla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101790010 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101790010 (STAT3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101790010 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:apla03000]
    101790010 (STAT3)
Transcription factors [BR:apla03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    101790010 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 Syntaxin-6_N Fib_alpha
Other DBs
NCBI-GeneID: 101790010
NCBI-ProteinID: XP_027301085
Ensembl: ENSAPLG00000007739
LinkDB
Position
28
AA seq 771 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQATHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRGIVSELAGLLSAMEYVQKMLADEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDVSSLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILW
YNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNY
SGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILS
TKPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNSMSFAEIIMGYKI
MDATNILVSPLVYLYPDIPKEEAFGKYCRSESQEHSEATDSGAAPYLKTKFICVTPTSFS
NTIDLPMSPRTLDSLMQFGNSSEGAEANAGGQFESLTFDMELTPECASSPM
NT seq 2316 nt   +upstreamnt  +downstreamnt
atggcgcagtggaaccagctgcagcagctcgacacgcgctacctggagcagctccaccag
ctctacagcgacagcttccccatggagctgcggcagttcctggccccgtggattgagagc
caggactgggcgtacgctgccaacaaggagtctcacgccacgctggtgttccacaacctg
ctgggggagatcgaccagcagtacagccgcttcctgcaggagtccaacgtcctctaccag
cacaacctgcggcgcatcaagcagttcctgcagagcagatacttggagaagccgatggaa
atagctcgcatcgtggctcgctgcctctgggaagagtcccggctcctgcagacggccgcc
accgcagcccagcaagggggacaggcgacgcatccgacagcagccgtggtgacagaaaag
cagcagatgctggagcagcacctgcaggatgtgaggaagagggtgcaggatctggagcag
aagatgaaagtggtggagaatctccaggatgactttgattttaactacaagactttgaaa
agccaaggggacatgcaggatctgaacgggaacaaccagtcggtgacacggcagaagatg
cagcagctggaacagatgctcacggcgctggaccagatgcgaagggggatcgtgagcgag
ctggctggcctgctgtcagccatggagtacgtgcagaagatgctggcagacgaggagctg
gcggactggaagagacggcagcaaatcgcttgcatcggcggcccaccaaatatctgcttg
gaccggctggagaactggataacctctcttgccgaatcgcagctacagacccggcagcag
atcaagaagctggaagagctgcaacagaaagtgtcctacaagggcgaccccatcgtccag
caccggcccatgctggaggagcgcatcgtggagctcttcaggaacctgatgaaaagcgcg
ttcgtggtggagaggcagccctgcatgcccatgcaccccgaccggcccctggtcatcaaa
accggcgtgcagttcaccaccaaagtcaggttgttggtgaagttccccgagctgaattac
cagctgaagatcaaagtctgcatcgacaaggactctggtgatgttgcagcactccggggg
tcgcggaagtttaacatcctggggacgaacaccaaggtcatgaacatggaggagtccaac
aacggcagcctctcggcggagttcaagcacctgaccctgcgggagcagcgatgcgggaac
ggaggcagagccaactgcgatgtaagctcgctgatcgtgaccgaggagctgcacctcatc
accttcgagacagaggtgtaccaccaggggctgaagatcgacctggagacccactcgctg
cccgtggtggtgatctccaacatctgccagatgcccaacgcctgggcgtccatcctgtgg
tacaacatgctgaccaacaaccccaagaacgtcaacttcttcaccaagccccccatcggg
acgtgggaccaggtggcggaggtgctgagctggcagttctcctccaccaccaagcgaggc
ctcagcatcgagcagctgacgacgctggccgaaaaactgcttgggccaggtgtgaattac
tcgggctgtcagatcacctgggccaagttctgcaaggagaacatggctgggaaaggcttc
tcgttttgggtctggctggacaacatcatcgacttggtgaagaaatacatcctggcgctg
tggaacgaggggtacatcatgggcttcatcagcaaggagcgggagcgagccatcctcagc
accaagcccccgggcaccttcctgctgcgattcagcgagagcagcaaggagggcggcatc
accttcacctgggtggagaaggacatcagcgggaaaacccagatccagtccgtggagcct
tacaccaagcagcagctgaacagcatgtcgttcgccgagatcatcatgggctacaagatc
atggacgccaccaacatcctggtgtcccccctggtctacctgtaccccgacatccccaag
gaggaggcgtttgggaagtactgccgctccgagagccaggagcactcggaagccaccgac
tcaggtgctgctccctatctaaagaccaagttcatctgtgtcacccccacctccttcagc
aacaccatcgacctgcccatgtccccgcgcaccctggactcgctcatgcagttcggtaac
agcagcgagggagccgaggccaacgcgggcggccagttcgagtcgctgaccttcgacatg
gagctgaccccggagtgcgcttcttcaccgatgtga

DBGET integrated database retrieval system