KEGG   Anas platyrhynchos (mallard): 101790135Help
Entry
101790135         CDS       T02816                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00590  Arachidonic acid metabolism
apla01100  Metabolic pathways
apla04370  VEGF signaling pathway
apla04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    101790135 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    101790135 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101790135 (PTGS2)
Enzymes [BR:apla01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     101790135 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 101790135
NCBI-ProteinID: XP_027318239
Ensembl: ENSAPLG00000013877
LinkDB All DBs
Position
8
AA seq 603 aa AA seqDB search
MILPCALVLGLLAAGHAANPCCSNPCQNRGVCMTTGFDRYECDCTRTGYYGENCTTPEFF
TWLKLTLKPTPNTVHYILTHFKGVWNIINNIPFLRDTIMRYVLTSRSHLIDSPPTYNSDY
NYKNWETYSNLSYYTRSLPPVGRDCPTPMGVKGKKELPDSKLIVEKFLLRKKFIPDPQGT
NVMFTFFAQHFTHQFFKTDHKKGPGFTKALGHGVDLNHIYGETLERQLKLRLLKDGKLKY
QMIDGEMYPPTVKDTQAEMIYPPHVPEHLQFSVGQEVFGLVPGLMMYATIWLREHNRVCD
ILKQEHPEWDDEQLFQTTRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQRFQYQ
NRIAAEFNTLYHWHPLLPDTFQIHDQEYTFQQFLYNNSIMLEHGLSHMVKSFSKQSAGRV
AGGKNVPAAVQKVAKASIDQSRQMRYQSLNEYRKRFMLKPFKSFEELTGEKEMAAELEEL
YGDIDAMELYPGLLVEKPRPGAIFGETMVEIGAPFSLKGLMGNAICSPEYWKPSTFGGKV
GFEIINTASLQKLICNNVKGCPFTAFHVLNPEPTEATINVSTSNTAMEDINPTLLLKERS
AEL
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgatcctaccctgcgcactggtcctcggtctactggctgccggccacgcagctaatcct
tgctgctcaaacccatgtcagaacagaggagtatgcatgacaacaggatttgaccggtat
gaatgtgactgcacaaggacaggatattatggggaaaattgtacaacaccggaattcttc
acgtggctgaaactaacattgaaacctacgccaaatactgtccattacattctcacccac
ttcaaaggagtctggaacatcatcaacaacatccccttcttacgagatactattatgaga
tatgtattgacgtcaagatcacatttgattgacagcccaccaacttacaatagtgactat
aattacaaaaactgggaaacttattccaatctttcctattacacaagaagccttcccccg
gtaggacgtgactgtccaacaccaatgggtgttaaaggtaagaaagaactcccagattca
aagctgattgtggagaagtttttgctgcggaaaaaatttattcctgacccacaaggcacg
aatgtgatgttcacattctttgcccaacacttcactcatcagttctttaagacagaccac
aagaaaggacctggtttcactaaagctcttggccatggggttgacttgaatcacatttat
ggagagactttggagagacagcttaaactgagacttctcaaggatggaaagctaaaatac
cagatgatagatggggaaatgtatccacccacagtgaaggacactcaggcagagatgatc
taccctcctcatgttcctgaacacttgcagttttctgtcgggcaggaggtgtttggtttg
gtcccaggtttaatgatgtatgctacaatatggctgagagaacacaatcgggtctgtgac
atcctgaaacaggagcatccagagtgggatgatgagcagttattccaaactactagactc
atattgataggagagacaatcaagattgttattgaagattacgtgcaacacttgagtggc
taccacttcaaactcaagttcgatcctgagcttctgttcaaccagcgattccaataccag
aaccgaattgcagctgaattcaataccctgtaccactggcacccacttctgcctgacact
tttcaaatacatgaccaggagtacactttccagcagttcctctacaacaactctataatg
ctggaacatggcctttcccatatggtgaaatctttctccaagcaaagtgctggcagggtt
gctggtggaaaaaatgttcctgctgcagtacagaaagtagcaaaggcttcaattgaccaa
agcagacaaatgagataccagtccttgaatgagtacaggaaacgcttcatgttgaaacca
tttaaatcatttgaagaacttacaggagaaaaagaaatggctgctgaactggaagagctt
tatggagacatagatgctatggagctgtatccaggactccttgtagaaaaaccacgacca
ggtgccatctttggcgaaacaatggtagaaatcggcgcaccattctctctgaaaggactg
atgggaaatgctatctgttccccagagtactggaagcccagcacctttggtggaaaagtg
ggatttgaaataatcaatactgcctccttacagaagctcatctgcaacaacgtgaaaggc
tgtcctttcactgctttccacgtcttaaatcctgaacccacggaggcaactattaatgtt
agtacctcaaacacagcaatggaagatatcaaccccacactactactgaaagagcgatct
gctgagttataa

DBGET integrated database retrieval system