KEGG   Anas platyrhynchos (mallard): 101791112
Entry
101791112         CDS       T02816                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00230  Purine metabolism
apla01100  Metabolic pathways
apla04020  Calcium signaling pathway
apla04114  Oocyte meiosis
apla04261  Adrenergic signaling in cardiomyocytes
apla04270  Vascular smooth muscle contraction
apla04371  Apelin signaling pathway
apla04540  Gap junction
apla04912  GnRH signaling pathway
apla04914  Progesterone-mediated oocyte maturation
apla04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101791112 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101791112 (ADCY3)
   04020 Calcium signaling pathway
    101791112 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101791112 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101791112 (ADCY3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101791112 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    101791112 (ADCY3)
   04916 Melanogenesis
    101791112 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101791112 (ADCY3)
   04270 Vascular smooth muscle contraction
    101791112 (ADCY3)
Enzymes [BR:apla01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101791112 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N Bax1-I HNOBA
Other DBs
NCBI-GeneID: 101791112
NCBI-ProteinID: XP_027311255
Ensembl: ENSAPLG00000013028
LinkDB
Position
3
AA seq 1305 aa
MLPVAAGPHLRSPRCRSREGGKERGGGDLGGAPRLKGVAPQKKKTGCPGRRGREGIATFF
RWQCAGAGGAGSAPLPAAAIYKSSPPPSPLSTTSSSSSSATSRLPPALFLRRGERKKKPP
RLPSSPKRGCPAERARSGGAGARGGKLGRKKKKKERKKKRNGAGRCAAMMRMMMPRHRAF
SEPECSAEYSADYSVSLPSDPEHGVGRTHEVTVRSSGPCLCLPRSARLTFAPESLENLYQ
TYFRRQRHETLLVLVVFAALFDAYVLATCALVYAEDKLAPLLVAALGLLAQALLFALCKS
RLLPERAARRFLPSVLWVLILAQIFCYLGLGFSRSPEASDTVGWQAFFVFSFFLTLPLRL
APIVLIAAVSCGVHTLVLGVTVAQQRQDALDEGALLRQLLSNVAIYLCAITVGTMSYYMA
DRKHRKAFLEARQSLEVKLNLEEQSQQQERLMLSILPKHVADEMLKDMKKDPSQKEMQQF
NTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAKYHQLRIKILG
DCYYCICGLPDYREDHAVCSIMMGLAMVEAISYVREKTKTAVDMRVGVHSGTVLGGVLGQ
KRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFEVEPGEGGSRCEYLKEKGI
VTYLIVVPKQPLRNGINGVKLSLTSSHGGSPLLVNTKERNGSLSVACATPDEAEEPDARA
RGTLESGEEDGEAVNPSFPNPRRRLRLRDLAERVIDASQNEQELNKLLNEALLERESVQA
LKGKSTFRLSMRFIDPEMETRYSVEKEKQSGAAFSCSCVVLFFTALVEVFIDPWLVANYV
TFVVGEILLLILTLCSLAAIFPRVFPKKLVAFSTWIDRTRWARNTWAMAAIIIVTTADIV
DMLSCWQDSGGLGNGTAAVPPPPRRPGGCGEQPKYYSYIALLALVATIMLVQVSHMVKLT
LMVLITGAAGTVNIYAWGHIFDHYDRRRGQQSARSALVPSKYSMTAMIFIVMLSFYYFSR
HVEKLARTLFLWKIDVHDQKERVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQS
YDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDALLDEPQFRCITKIKTIG
STYMAASGVTPDANANGYGAKKETLSDKERWQHLADLADFALAMKVTLMNINYQSFNNFM
LRIGMNKGAVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETHLILKEYGFR
FVRRGAIYVKGKGELLTFFLKGREKQGSFVNGSSVTLPHQVVDSS
NT seq 3918 nt   +upstreamnt  +downstreamnt
atgctcccggtggcggcggggccgcacctgcgctccccgcgctgccgcagccgggaggga
gggaaggagaggggcggaggggacctggggggggctcccaggctgaaaggggtcgccccc
caaaaaaaaaaaaccggctgccctggaaggaggggcagggaaggcatcgcgacatttttc
cgctggcagtgcgcaggggctgggggggccggctcggcaccgctcccggcagccgctatt
tataaatcctccccccccccttctccgctcagcaccaccagcagcagcagctccagcgca
acctctcgccttcctccggccctttttctccgccggggggagagaaaaaagaagcccccc
cgcctcccctcctccccaaaaaggggatgccccgctgagcgcgctcgctcggggggggcc
ggtgcgcgtggggggaaattggggcgcaaaaaaaaaaagaaagaaagaaagaaaaagaga
aacggagccgggcgatgcgcagcgatgatgaggatgatgatgccccggcacagggctttc
tccgagcccgaatgctcggccgaatattcggccgactactcggtcagcctcccctccgac
cccgagcacggagtggggcgcacccacgaagtgacggtgaggagctcggggccctgcctc
tgccttccccgctcggctcgcctcaccttcgcccccgaatccttggagaacctctaccag
acttatttccgaaggcagcgccacgaaaccctgctggtgctggtggtcttcgccgccctc
ttcgacgcctacgtcctggccacctgcgccctggtttacgccgaggacaaattggccccg
cttttggtggcggcgctcggtttgctcgcccaagctctcctcttcgccctctgcaaatcc
cggctgctgcccgagcgggcggctcgccgtttcctcccctcggtcctctgggtccttatt
ttggcccaaattttctgctacttggggctgggcttctcccgctcgcccgaggccagcgac
acggtgggctggcaggcgtttttcgtcttctccttcttcctcacgctgccgctgcgcctg
gcgcccatcgtgctcatcgccgccgtctcctgcggcgtccacacgctggtgctcggcgtc
accgtcgcccagcagcgccaggacgccctggatgagggggccttgctccgacagctcctg
tccaacgtggccatctacctgtgcgccatcacggtgggcaccatgtcctactacatggcc
gaccgcaagcaccgcaaagccttcctcgaagcccggcaatccctcgaggtcaagctcaac
ctggaggagcagagccagcagcaggagcggctgatgctctccatcctgcccaagcacgtg
gcggacgagatgctgaaggacatgaagaaggacccgagccagaaggagatgcagcagttc
aacaccatgtacatgtaccgccacgagaacgtcagcatcctcttcgccgacatcgtgggc
ttcacgcagctctcctcgtcctgcagcgcccaggagctggtgaagctcctcaacgagctc
ttcgcccgcttcgacaagctggcagccaaataccaccagctgcgcatcaagatcctgggc
gactgctactactgcatctgcgggctgcccgactaccgggaggaccacgccgtctgctcc
atcatgatggggctggccatggtggaggccatttcctacgtgcgggagaagaccaagacg
gcggtggacatgcgcgtgggggtgcacagcgggacggtgctggggggcgttttgggccag
aaacgttggcaatacgacgtctggtccaccgacgtcaccgtggccaacaagatggaagca
ggaggcatcccggggcgcgtgcacatctcgcagagcaccatggactgcttgaagggcgag
ttcgaggtggagccgggcgaggggggctctcgctgcgagtacctgaaggagaagggcatc
gtcacctacctcatcgtggtgcccaagcagcccctgcgcaacgggatcaacggggtgaag
ctgtccctcacctcgtcccacggcggctccccgctgctcgtcaacaccaaggagcgcaac
ggcagcctcagcgtggcctgcgccacccccgacgaggccgaggagcccgacgccagggcc
aggggcaccttggagagcggggaggaggatggagaggcggtgaacccctccttccccaac
ccgcggcgccggctgcggctgcgggacctggccgagcgggtgatcgacgcgtcgcagaac
gagcaggagctcaacaagctgctcaacgaagccctgctggagcgagaatccgtccaggcg
ttgaaggggaagagcacttttcggctctccatgcgcttcatcgaccccgagatggagacg
cgctactcggtggagaaggagaagcaaagcggggccgccttcagctgctcctgcgtcgtc
ctcttcttcaccgccttggtggaggtcttcatcgacccctggttggtggccaactacgtg
accttcgtggtgggggagatcctgctgctcatcctcaccctctgctcgctggcagccatc
ttcccccgggttttccccaaaaaactcgtcgccttctccacctggattgacaggacccgc
tgggcgcgcaacacctgggccatggctgccatcatcatcgtcaccacggccgacatcgtg
gacatgctcagctgctggcaggactccggagggctgggcaacggcacggcagcggtgcca
ccgccgccgcggcggccggggggctgcggggagcaacccaaatattacagctacatcgcc
ctgctggccctggtggccaccatcatgctggtgcaggtcagccacatggtcaagctgacc
ctcatggtgctgatcaccggggcggccggcaccgtcaacatctacgcctgggggcacatc
ttcgaccactacgaccgccgccggggccagcaaagcgccaggtcggcgctggtcccctcc
aaatattcgatgacagccatgattttcatcgtgatgctcagcttctactacttctctcgc
cacgtggagaagttggccaggaccctcttcctttggaaaatcgacgtccacgaccagaag
gagcgggtctacgagatgcggcgctggaacgaggccctggtcaccaacatgctccccgag
cacgtggcccggcacttcctgggctccaaaaaacgcgacgaggagctttacagccagtcc
tacgacgagatcggcgtcatgttcgcctccctgcccaacttcgccgacttctacaccgag
gagagcatcaacaacgggggcatcgagtgcctgcgcttcctcaacgagatcatctccgac
ttcgacgcgctcctggacgagccccaattccgctgcatcaccaaaatcaaaaccatcggc
agcacctacatggctgcttctggagtcacccccgacgccaacgccaacggctacggcgcc
aagaaggagaccctgtcagataaggagcgctggcagcacttggccgatctggccgatttc
gccttggccatgaaggtgacgttgatgaacatcaactaccagtccttcaacaacttcatg
ctccgcataggcatgaacaagggcgccgtgctggcgggcgtcatcggtgcccggaaaccc
cactacgacatctggggcaacacggtgaacgtggccagcaggatggagtccacgggcgtg
atggggaacatccaggtggtggaggagacccacctgatcctgaaggagtacggcttccgc
ttcgtgcgccgcggggccatctacgtcaagggcaaaggggagctgctcaccttcttcctc
aagggccgggagaagcaaggctccttcgtcaacggctcgtccgtcaccctgccccatcag
gtggtggacagctcctga

DBGET integrated database retrieval system