KEGG   Anas platyrhynchos (mallard): 101791236Help
Entry
101791236         CDS       T02816                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla04010  MAPK signaling pathway
apla04210  Apoptosis
apla04625  C-type lectin receptor signaling pathway
apla04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:apla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101791236 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101791236 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101791236 (MAP3K14)
   04672 Intestinal immune network for IgA production
    101791236 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:apla01001]
    101791236 (MAP3K14)
Enzymes [BR:apla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     101791236 (MAP3K14)
Protein kinases [BR:apla01001]
 Serine/threonine kinases: STE group
  Other
   101791236 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 101791236
NCBI-ProteinID: XP_005026264
Ensembl: ENSAPLG00000004431
UniProt: R0KTH0
LinkDB All DBs
Position
28
AA seq 944 aa AA seqDB search
MAVMGITCQGAPDPTVKHKKELTATKGLNKTVSEKQSSVCKVEDSKKGIFHSQWKILNDV
ITKGTAKEETEGGCASISIIAQAECENSQEFSPTLSERSFIAHTKRYSRSDSLDQIPNNV
AHATEGKMAPTCWRGRHRGKTRKKRHKKRSKLKIQTVAAGRRGPRTPEQESCTPIPVQED
ETHQSTLLRNNFWLSELNKDLIYDPLPFEKPEKVLSTGKLHLPKSQYKTELHKLISPVQC
LNHVWKLHYQRDSVPQPETLHPLPYNIIPPHFPHLDSPLHHKKLNALETYFHGNLNYQDS
EHRLSGLNLEYSFPNCVNQSMQNSSDKISVEEYLVDALKGSVSLGEPQNLASLAKTWRGG
GLDLKEQFQRADENEGVLLTEKLKPVDYEYREEVHWTKCHGSLGIGSFGEVYKIEDKQTG
FQCAAKKVQVEHFRAEELTTCAAITSPKVVPLYGAVKEGPWVTIFMKLMEGGSLGQLIKQ
NGCLPEDRALSYLGQALEGLEYLHAQNILHGDVKAENVLLSDDGSRALLCDFGHSAHLHP
DGLGKCLVTGNYVPGTETHMAPEVVMGKRCDSKVDVWSSCCMMLHMLNGCHPWTQYYNHP
LCLKIAKEPPPLREIPPSCNPLTAEIIKMGLEKEPVQRASASELKTKTSVALEEVGGVTS
PWKGEYREPRHLSLNKENNPQTSLSPTVSPVSETHSDPKLADKVSCVSPVLPPPPPLEQT
EEVEGTPWNVCKELSGIWDPPPLSSTPLPLKSCSHVEKATTISEQELQQLEIELFLNSLS
QPYSLEEQEQMLSCLSIDSPFVSDASEKNSMKASHSLRDTMSSGIHSWNSQTDGQSFSFN
NLLNRSRHTDTPSYFNGVKIQVQLLSGENLHIRDFQRTKVGDIATGISSQVRVPAFSLVT
KEGQPVHYDMEVPDSGIELQCTLAPDCSVSWTWRVKHGQLENRP
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatgggaattacgtgccaaggagctcctgatccaactgtcaagcataagaag
gagctcacagctacaaagggactgaacaagacagtgagtgaaaagcaaagtagtgtttgc
aaagtagaagattcgaagaagggcatctttcatagtcagtggaaaatcctgaatgatgta
atcaccaaaggaactgcaaaagaagaaacagaaggaggctgtgcatcaatttctattatt
gcccaagcagaatgtgaaaacagtcaggaattcagccccactttatcagagagatctttt
attgctcatactaaacgttacagccgctcagacagtcttgatcaaatccccaacaatgtg
gcccacgcaacagaggggaaaatggcacctacctgttggagagggaggcatcgtggtaaa
acaagaaagaaacgtcacaagaaacgatccaagctgaaaatacaaacagtggctgctggc
aggcgaggtcccagaactccagaacaagagagctgcaccccaattccagtccaggaggat
gaaacacaccaaagtactcttctcagaaacaatttttggttgtcagaacttaacaaggat
ttgatttatgatccgctgccatttgagaaacctgagaaagttctgtccacaggcaaactc
catttaccaaagagccaatacaaaacagaactgcacaagctgataagccctgttcagtgc
cttaatcacgtgtggaaactgcactatcaaagggacagtgttccacagcctgaaactctc
catccccttccatacaacattataccccctcatttcccacatctggacagtcctctccat
cacaagaaactgaatgctctggagacatatttccatggcaatctcaactatcaagacagt
gagcatcgcttatctgggctaaacttggaatatagtttccccaactgcgtcaaccagtcc
atgcaaaacagttcggacaagatttctgtggaagaatacttggtagacgccttgaagggg
agtgtgagtctcggtgaaccacaaaatttagccagcctagccaagacgtggagaggaggc
ggtctggacctgaaggaacaatttcaaagagcagatgaaaacgaaggcgtgctacttacc
gagaaactaaagccagtggattacgagtaccgagaagaagttcattggaccaagtgtcat
ggttccttgggcattggctcttttggagaagtatacaaaatagaggacaagcagacagga
tttcagtgtgctgccaaaaaggtacaagttgaacacttccgtgcagaggagttgacaacg
tgtgctgcaataaccagtcctaaagttgtccccttgtatggagctgtgaaggaaggacct
tgggtgaccatcttcatgaagctgatggagggtggctcactaggtcagctaattaagcag
aatggctgcctgccggaggacagagccctcagttatttgggccaagcattagaaggcttg
gagtatcttcatgctcagaacattctccatggagatgtaaaagcggaaaatgtgcttttg
tctgatgatggaagcagggctcttctgtgtgattttggtcactctgctcaccttcatcca
gatggcttgggaaagtgcttggtcacagggaactatgtgcctggcacagaaactcacatg
gctccagaggtggtcatgggaaaacgctgcgactccaaagtggatgtctggagcagttgc
tgtatgatgctgcacatgcttaatgggtgtcacccttggacccaatattacaatcatcct
ctctgtctgaaaatagctaaagagccacctcctctgagggaaattccaccttcctgcaac
cctctcactgctgaaattattaaaatgggtctggagaaagagcctgttcagcgagcatct
gcatctgaactgaaaaccaagaccagtgttgcacttgaagaagtgggaggtgtgacaagc
ccctggaaaggcgaatacagagagcctagacatctatctctgaacaaagaaaacaatcca
cagacatccctgtcccccacagtgagcccagtgtctgagactcattctgacccaaaattg
gcagacaaagtttcttgtgtaagcccagtcttaccaccaccaccacctctggaacaaaca
gaagaggttgagggaaccccttggaacgtgtgcaaggagttatctgggatctgggatcca
ccacctctctcctcgactcctctccccctgaagagctgcagccatgtggagaaagcaaca
accatttcagaacaagagcttcagcagctggaaatagaactgtttttgaacagcctttca
cagccttactcgctggaagagcaagaacaaatgctttcatgtctcagcatcgacagccca
tttgtgtcagatgccagtgagaagaactccatgaaggcttcgcatagcttgagggacact
atgagctcagggattcattcctggaacagccagacagatggacagagcttcagctttaac
aacctactgaatcgcagccgtcacacggacactcctagctatttcaatggagtgaaaatc
caggtccagttgctaagcggagaaaatttacacatcagggatttccagagaacaaaggtg
ggagacattgccactgggataagcagccaggtacgggtccctgccttcagtctggttacc
aaagaaggccagccagtgcactacgacatggaggtccccgactccggtattgagctgcag
tgcacccttgcccctgactgcagtgtcagctggacgtggagagtcaaacacggtcaactg
gagaacaggccgtga

DBGET integrated database retrieval system