KEGG   Anas platyrhynchos (mallard): 101791526Help
Entry
101791526         CDS       T02816                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
apla  Anas platyrhynchos (mallard)
Brite
KEGG Orthology (KO) [BR:apla00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:apla01002]
    101791526 (TMPRSS9)
Enzymes [BR:apla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     101791526 (TMPRSS9)
Peptidases [BR:apla01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101791526 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Ldl_recept_a Trypsin_2
Motif
Other DBs
NCBI-GeneID: 101791526
NCBI-ProteinID: XP_012951335
Ensembl: ENSAPLG00000011476
LinkDB All DBs
Position
Un
AA seq 1077 aa AA seqDB search
MDQVKPVPGRKGRKASCWKLTVVAAVVGSVMALYMGILLACHPVGETSFEHTVELQGIIF
NSSLQRENSDYYRVLTPALERLFLSSFQDSQLDWSCTGCTILGYSGEPVLCSPVPPGSST
RAAAQLPAASHGDTGSAGKQGSCPGDLFTCRNKQCVSKENPECDGQKDCSDASDEKGCDC
GSRPAMQTATRIVGGSEASRGEFPWQVSLRENNEHFCGAAILTEKWLVSAAHCFTEFQDP
AMWAAYTGTTSISGMDKGTVKMGIARIIPHPSYNTDTADYDVAVLELKRPVTFTKYIQPV
CLPDAGHHFPTSKKCLISGWGYLKEDFLVKPEFLQKATVELLDQTLCSSLYSHALTDRML
CAGYLEGKIDSCQGDSGGPLVCEEPSGKFFLAGIVSWGIGCAEARRPGVYTRVTKLRDWI
LDAISPFPNSIERTVPLMHSSTNSNVVTTEELNTTTPRAIPTTSPAPAASKPAPAARPQE
CGGRPGLSKPSKIVGGTDASRGEIPWQVSLKEDSMHFCGATIIGDRWLLSAAHCFNETDP
EEIEAYMGTTSLNGTDNNTVRVNVTRVIQHPLFNPILLDFDVAVLELAEPLVFSKYIQPI
CLPLTVQKFPVGKKCIISGWGNLQEGNFTKPESLQKASVGIIDQKTCNFLYNFSLTDRMI
CAGFLEGKIDSCQGDSGGPLACEVTPGVFYLAGIVSWGIGCAQAKKPGVYSRITKFYDWI
LDTISQYASPGTSTPSSSAITSTSTAAILTRHASTTAAIAISRTTLSMKTTTPTKETSTA
LGTTEPAKPTQTPVVPCTSFTFRCSSNVCIGKENPECDGVVDCSNGFDESNCDCGLTSAL
AFSKIVGGSTAARGEWPWQVSLWLRRKEHKCGAVLIADRWLLSAAHCFDIYSDPKMWVAF
LGTPFLNGIDGKMEKIFRIYKHPFYNIYSLDYDVALLELNMPIKFSSTIKPICLPASSHI
FHEGARCFITGWGSTKEGGLMSKDLQKAAVNVIGDQACKKFYPVQISSRMVCAGFPHGTV
DSCSGDAGGPLACQEPSGRWFLAGITSWGYGCARPYFPGVYTKVTAVQGWIAQNLKL
NT seq 3234 nt NT seq  +upstreamnt  +downstreamnt
atggaccaagtaaagccagtgccaggcagaaagggacggaaggccagctgctggaagtta
accgttgtggccgccgtagtgggcagcgtgatggctctctacatggggatcctgctggct
tgtcatcccgtgggagagaccagctttgagcacacagtggagctgcaaggaatcatattc
aacagcagcttgcagagggagaactcggactattacagggtgctgacgcctgctcttgag
aggctgtttctgtccagtttccaggattcccagctggactggagctgcactggttgcacc
atcctgggctacagtggtgaaccagtgctctgctcccctgttccccctggaagctcaaca
agagctgcagctcagctgccggctgcatcccatggggacactggcagtgccgggaagcag
gggagctgccccggagacttgttcacttgccgcaacaagcagtgcgtgtcgaaagaaaac
ccagaatgtgatggccaaaaggactgctctgatgcctctgatgaaaagggctgcgactgc
gggagccgccctgccatgcagactgccaccaggatagttggaggctcagaggcatccaga
ggggagttcccatggcaagtcagcctgcgagagaacaacgaacatttctgtggtgctgca
atcctcacagagaagtggctggtgtctgctgctcactgctttactgagtttcaggaccca
gccatgtgggcagcttacacggggaccacttccattagcggtatggacaaaggcacagta
aaaatgggcattgcacggatcatcccgcatccctcctacaacacagacacagctgactac
gatgtggctgtgctggagctgaagagacccgtgacctttactaagtacatccagcctgtg
tgcctgccagatgctgggcatcacttccccaccagcaagaagtgccttatctctggctgg
ggctacctcaaggaggatttcttggtgaaacccgagttcctgcagaaagcaacagtggag
ctgctggaccagacgctgtgctccagcctctacagccatgccctcacagacaggatgttg
tgtgctggctacctggaggggaaaatagattcctgccagggtgactctggtgggcccctg
gtttgtgaagaaccatctggcaagttcttcctggcaggaattgtgagctggggaattgga
tgtgctgaagccagacggcctggggtctacacacgtgttaccaaactgagagactggatc
ttggatgctatttcgccctttcccaactccatagagcgtactgtcccactaatgcactcc
agtactaacagtaacgtggtcaccactgaagagctcaacaccaccacccccagagcaatc
cccaccacctcaccagccccagctgccagcaagccagcacctgcagccagaccgcaagag
tgtggaggacgacctgggctctctaaacccagcaagatcgtgggaggaacagatgcttcc
agaggagagatcccctggcaagtcagcctgaaagaagactcgatgcatttctgtggagcc
accataattggggaccgctggctgctgtcagcagctcactgcttcaatgagacagatcca
gaagagattgaagcctacatgggaacgacatcactaaatggaacagataataacacagtg
agagtcaacgtaacaagggtcatccagcatcctctcttcaaccctatccttctggacttc
gacgtggctgtacttgagctggcagaaccccttgtcttcagcaaatacatccagcccatc
tgcctcccgcttacggtgcagaagtttcctgttggcaagaaatgcatcatttctgggtgg
ggaaacctccaagaagggaatttcaccaagcctgagagtctgcagaaagcttctgtgggc
atcattgaccagaagacctgcaacttcctctacaacttctccctcactgaccgaatgatc
tgtgctggcttcctggaagggaagatagactcgtgccagggagattcaggtgggcccttg
gcctgtgaggtcaccccaggtgtcttttatctggctggcatcgtgagctggggaattggc
tgtgcccaggctaagaaacctggcgtgtactccagaattaccaaattctacgactggatc
ctggataccatctcgcagtatgccagtcctggcacaagcactccttccagttcagccatc
accagcacttctactgcagccatcctcacacgccacgccagtacaacagctgcaatagcc
atcagcagaaccaccctgagcatgaagaccaccacacccacaaaagaaacctccactgct
ctgggaaccacagagcctgccaagcccacccaaaccccagtggtgccttgtaccagcttc
accttcaggtgttccagcaatgtctgtattggaaaggaaaatcctgaatgtgatggagtt
gttgactgcagcaatggctttgatgaaagcaattgtgactgtggcttaacttctgctctg
gccttcagcaagatcgtgggtgggagcactgcagctcgaggagaatggccctggcaagtc
agcctctggcttcggcggaaggagcacaagtgcggggctgtcctcatcgctgacaggtgg
ctgctctctgcagctcactgctttgatatttacagtgaccccaaaatgtgggtggccttt
ctaggaacacccttcctgaatggcatcgatggcaaaatggagaaaatattccgtatctac
aagcaccctttttacaacatctacagcctggactacgacgtggcgctgctagagctgaac
atgcccatcaagttcagcagcaccatcaaacctatatgtctcccagccagttcacacatc
ttccacgaaggagccagatgcttcatcacaggctggggttccacgaaggaaggaggtcta
atgtcaaaggatctgcaaaaagcagcagtgaatgtgattggagaccaggcctgcaaaaag
ttctaccctgtccagatcagcagcaggatggtgtgtgctggtttcccacacggtaccgtc
gacagttgttcgggtgatgctggcggtcctctggcatgtcaagaaccctcgggaaggtgg
tttctagcaggaatcacaagctggggctacggctgtgccaggccgtactttcctggtgtc
tacactaaagtcacagctgtccaaggctggattgcgcagaacctcaagctctga

DBGET integrated database retrieval system