KEGG   Anas platyrhynchos (mallard): 101791654
Entry
101791654         CDS       T02816                                 

Definition
(RefSeq) arylamine N-acetyltransferase, pineal gland isozyme NAT-10
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00232  Caffeine metabolism
apla00983  Drug metabolism - other enzymes
apla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    101791654
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101791654
Enzymes [BR:apla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     101791654
SSDB
Motif
Pfam: Acetyltransf_2
Other DBs
NCBI-GeneID: 101791654
NCBI-ProteinID: XP_005020219
Ensembl: ENSAPLG00000002088
UniProt: R0L5N3
LinkDB
Position
12
AA seq 290 aa
MNLEEYFARTGYKGSLENQDLETLTDIFQHHIRAVPFENLSIHCGEKITLELEHVYNKIV
RRKRGGWCMENNQLLGWVLKCLGYDASFLGAYVFNPHENAYANIMTHLLVKVVIDGKAYI
VDGGFGVSYQMWQPMELVSGKDQPQAPGVFRFTEKNATWYLEKMRRKQYIPNQNFSNSDL
LEKKECRKVYMFSLEPRTVEDFRFQCTYLQTSPDSLFTKKSICTLQTTDGFRALIGWTLT
ETTYNYKENMDLVEFITLKDEEVEKTLKEKFNITLERKLIPINVKGFYTI
NT seq 873 nt   +upstreamnt  +downstreamnt
atgaaccttgaagaatattttgcaagaaccgggtataaaggttcccttgaaaatcaagat
ctggaaactctaacagatatattccagcaccacatccgtgctgttccatttgaaaacctc
agcatccattgtggggagaaaattactttggagttggagcacgtttataacaaaatcgtg
cggaggaagcgtggtggctggtgcatggaaaacaaccagctgctaggttgggtcctgaaa
tgcctggggtacgacgccagctttctgggagcgtacgtgttcaacccacacgaaaacgca
tatgccaacatcatgacccatctcctagtgaaggtagttattgatgggaaagcctacatt
gttgatggaggctttggtgtatcctatcaaatgtggcagccgatggagcttgtgtcaggg
aaagaccagccccaggcgcccggtgtctttcgtttcacagaaaaaaatgccacctggtac
cttgagaaaatgagacggaaacaatatatccccaatcaaaatttctcaaattctgatctt
ctagagaaaaaagagtgtcggaaagtgtatatgttcagtcttgaaccacggacagtggaa
gatttccgtttccagtgtacgtaccttcagacatctccagattccctctttacgaagaag
tctatctgcacactccaaaccaccgatggctttcgagcgctcattgggtggacgctcacg
gagaccacgtacaattacaaggagaacatggatctggtggaatttataacccttaaagat
gaagaggtggagaagacactgaaagagaagttcaacatcacgttagagagaaaacttatc
ccaattaacgtcaaaggattttacacaatctag

DBGET integrated database retrieval system