KEGG   Anas platyrhynchos (mallard): 101791694
Entry
101791694         CDS       T02816                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla04012  ErbB signaling pathway
apla04068  FoxO signaling pathway
apla04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:apla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101791694 (CDKN1B)
   04068 FoxO signaling pathway
    101791694 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101791694 (CDKN1B)
SSDB
Motif
Pfam: CDI US6
Other DBs
NCBI-GeneID: 101791694
NCBI-ProteinID: NP_001297335
UniProt: Q6QWC3
LinkDB
AA seq 198 aa
MSNVRISNGSPTLERMEARQSEYPKPSACRNLFGPVNHEELNRDLKKHRKEMEEACQRKW
NFDFQNHKPLEGRYEWQAVEKGSSPEFYFRPPRLLKAVCKSAGHQSLDVNGNCQTVIFAG
SQGISEDTHCVDQKTALSEKQTDFAEQCTGQRKRPATDDSSPQNKRANTTEEEVSEDSPS
ASSVEQTPKKSSPRRHQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtacgcatttctaatgggagccctaccctggagcgcatggaagcccggcag
tcggaatacccgaagccgtcagcctgcaggaatctcttcgggccggtgaaccacgaagag
ttaaacagggacttgaagaagcaccgcaaggagatggaggaggcatgccagaggaagtgg
aatttcgatttccagaatcacaagccgctggaaggcaggtacgagtggcaagccgtggag
aaggggagctcgcccgaattctacttcagacccccgaggctactcaaagctgtctgcaag
tccgccggccaccagagcctggatgtaaacgggaattgccaaaccgtgatttttgccggt
tctcagggaatctcagaggacactcactgtgtagatcaaaagactgctctttctgaaaag
cagacggactttgcagagcagtgcactgggcagaggaaaagacctgccaccgacgattcc
tctcctcaaaataaaagagccaacacaacagaagaagaggtttcagaagactcccccagt
gccagttcagtggagcaaacacccaagaaatcaagcccgagaagacatcaaacgtaa

DBGET integrated database retrieval system