KEGG   Anas platyrhynchos (mallard): 101791856Help
Entry
101791856         CDS       T02816                                 

Gene name
PRKACB
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X3
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla04010  MAPK signaling pathway
apla04020  Calcium signaling pathway
apla04114  Oocyte meiosis
apla04140  Autophagy - animal
apla04261  Adrenergic signaling in cardiomyocytes
apla04270  Vascular smooth muscle contraction
apla04310  Wnt signaling pathway
apla04340  Hedgehog signaling pathway
apla04371  Apelin signaling pathway
apla04530  Tight junction
apla04540  Gap junction
apla04910  Insulin signaling pathway
apla04912  GnRH signaling pathway
apla04914  Progesterone-mediated oocyte maturation
apla04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:apla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101791856 (PRKACB)
   04310 Wnt signaling pathway
    101791856 (PRKACB)
   04340 Hedgehog signaling pathway
    101791856 (PRKACB)
   04371 Apelin signaling pathway
    101791856 (PRKACB)
   04020 Calcium signaling pathway
    101791856 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101791856 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101791856 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101791856 (PRKACB)
   04540 Gap junction
    101791856 (PRKACB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101791856 (PRKACB)
   04912 GnRH signaling pathway
    101791856 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    101791856 (PRKACB)
   04916 Melanogenesis
    101791856 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101791856 (PRKACB)
   04270 Vascular smooth muscle contraction
    101791856 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:apla01001]
    101791856 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:apla03019]
    101791856 (PRKACB)
   03036 Chromosome and associated proteins [BR:apla03036]
    101791856 (PRKACB)
Enzymes [BR:apla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     101791856 (PRKACB)
Protein kinases [BR:apla01001]
 Serine/threonine kinases: AGC group
  PKA family
   101791856 (PRKACB)
Messenger RNA biogenesis [BR:apla03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     101791856 (PRKACB)
Chromosome and associated proteins [BR:apla03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101791856 (PRKACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 101791856
NCBI-ProteinID: XP_005022336
Ensembl: ENSAPLG00000016236
UniProt: R0JPM8
LinkDB All DBs
Position
8
AA seq 397 aa AA seqDB search
MAAQKEVPCNQCTGTATALQRLEGFANRLFHRHSKGGTHEQRVPLENESHFSELAVLWDK
SMKEFLAKAKEDFLRKWESPPQNTAGLDDFERQKTLGTGSFGRVMMVKHKATEQYYAMKI
LDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEYSFKDNSNLYMVMEYVPGGEMFSHLR
RIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKG
RTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSG
KVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAP
FIPKCRGPGDTSNFDDYEEEDIRASLTEKCAKEFADF
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcagaaggaggtaccttgtaaccagtgcacagggactgccaccgcgctccag
agactggaaggtttcgctaaccgcctcttccataggcactcaaagggtggtacacatgaa
cagagagtgcctctggaaaatgagagccatttctctgaacttgctgtcctgtgggacaaa
tcaatgaaagagttcctagccaaagccaaagaagactttttaagaaaatgggaaagcccc
cctcagaatactgctggcctagatgattttgagaggcaaaaaaccctaggaacaggatca
ttcgggagagttatgatggtgaaacataaagccacagaacagtattatgctatgaagata
ctggacaaacagaaggttgtcaaactgaagcaaatagaacacacactgaatgaaaagaga
atattacaagcggtgaactttcctttccttgtaaaactggagtattcttttaaggacaat
tctaatttatacatggtaatggagtatgttcctggtggtgaaatgttctcacatctaaga
agaattggaaggtttagtgaaccacatgcacggttttatgcagctcagatagtgctaaca
tttgagtacctccattcgttagacctcatctacagagatctaaagcctgaaaatctttta
attgatcagcaaggatacatccaggtcacggactttggctttgcaaaaagagtaaaagga
agaacttggacgttatgcgggactccagaatatctggcacctgaaataattctcagcaag
ggttacaacaaggcagtggattggtgggcattaggagtgttaatctatgaaatggcagct
ggatatcccccattctttgcagatcagccaattcaaatttatgaaaagattgtgtctggc
aaggtaaggttcccatcacacttcagttcagacctgaaggatcttctaagaaatttactc
caggtagatttgaccaaacgatatggaaatctcaagaatggtgtaaatgacataaagaat
cacaagtggtttgcaactacagattggattgccatttatcagagaaaggtagaagctcca
ttcataccaaagtgcagaggccctggagatacaagcaactttgatgactatgaagaagaa
gatattcgtgcgtctctaacagaaaaatgtgcaaaagaatttgctgatttttag

DBGET integrated database retrieval system