KEGG   Anas platyrhynchos (mallard): 101792092Help
Entry
101792092         CDS       T02816                                 

Gene name
GALNT17
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 17 isoform X1
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00512  Mucin type O-glycan biosynthesis
apla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    101792092 (GALNT17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:apla01003]
    101792092 (GALNT17)
Enzymes [BR:apla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     101792092 (GALNT17)
Glycosyltransferases [BR:apla01003]
 O-Glycan biosynthesis
  Mucin-type
   101792092 (GALNT17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 RicinB_lectin_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 101792092
NCBI-ProteinID: XP_027301705
Ensembl: ENSAPLG00000015843
LinkDB All DBs
Position
29
AA seq 598 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPITAKSGDSFHDVHPRAEVVNLTAHGIGSIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPEEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYGKDLPQISIIFIFVNEALSVILRSVHSAVNHTP
AHLLKEIILVDDNSDEEELKAPLEEYVNKRYPGLVKVVRNQKREGLIRARIEGWKAATGQ
VTGFFDAHVEFTAGWAEPVLSRIQENRRRVILPSIDNIKQDNFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVHRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNNNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERKALRKSLKCKNFQWYLDHVYPEMRRYNNTVAYGELRNNKAKDVCLD
QGPQENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNVKSRFPQLLD
CEKVKSSLHKRWNFIQNGAILNKGTGRCLEVENRGMAGIDLILRSCTGQRWTIKNFIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttctttgcggagagtcaaagtcctgctggtgttaaacttgatcgcggtggccggc
ttcgtcctcttcctggccaagtgcagacccatcacggccaagagcggcgactccttccac
gacgtccatccccgggcagaagtggtcaacttgacagcccacggcatcggctccatccag
gatgcggtgctgaagaggctctccctcctggaagacatagtctacaggcagctcaatggt
ctgtccaagtcacttggtctcattgaaggctatggtggacgtggcaaaggtgggcttcca
gccaccctgtcccctgaggaggaggagaaagctaagggaccccatgagaaatacggctac
aactcctacctcagtgagaaaatttcactggatcgttccataccagattatcgtccaacc
aagtgcaaagagctgaaatacggcaaggacctaccccagatctccattatcttcatcttc
gtgaacgaagcactgtcggttatcctgcggtcggtgcacagcgctgttaatcatacccca
gctcacctgctgaaggagattatccttgtggatgacaacagtgatgaagaggaactgaag
gcgccgctggaggaatatgtcaacaaacgatacccggggctggtgaaggtggtgcgcaac
cagaagagggagggccttatccgcgcgcgcatcgagggctggaaggctgccacgggccag
gtcactggattttttgatgcccacgtggagttcacggctggctgggctgagccagtactc
tcgcgaattcaggagaatcgaagaagggtcattcttccctccatcgacaacatcaagcag
gacaactttgaggtgcagcgctacgagaactctgcccatgggtacagctgggagctgtgg
tgcatgtacatcagcccccccaaggactggtgggacgctggggacccctcattgcccatc
agaacaccagcgatgattggttgctcctttgttgtgcacaggaagttctttggagagatt
gggctccttgatcctgggatggatgtgtacggaggggagaacatagagctcggcatcaag
gtgtggctctgcggtggcagcatggaggtcctgccctgctccagggtggctcacatcgag
cgcaagaagaagccctacaacaacaacatcggtttctacaccaagcgcaacgccctgcga
gtggctgaggtgtggatggatgactacaagtcccatgtctacattgcatggaacttgcct
ctggagaatccaggtattgacattggggatgtctctgagagaaaagctttgaggaagagc
ttgaagtgtaaaaattttcagtggtatctggaccacgtttatccagaaatgagaagatac
aacaacaccgttgcgtatggcgagcttcgaaacaacaaggcgaaggatgtttgccttgac
cagggcccgcaggagaaccacacagcaatattgtacccgtgccacggctggggaccacag
cttgcacgctacaccaaggaggggttccttcatctcggcgccctcgggaccacgactctt
ctgcccgacacccgctgcctggtggataacgtgaaaagccgcttccctcagctcctcgac
tgcgaaaaggtcaagagcagcctccataagcggtggaatttcatccagaatggtgccatc
ttgaacaagggaacagggcgctgcttggaagtggagaacagaggaatggctggcatcgat
ctgattcttcgcagctgcacaggacaaaggtggacaattaaaaatttcatcaagtaa

DBGET integrated database retrieval system