KEGG   Anas platyrhynchos (mallard): 101792265Help
Entry
101792265         CDS       T02816                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00020  Citrate cycle (TCA cycle)
apla00190  Oxidative phosphorylation
apla01100  Metabolic pathways
apla01200  Carbon metabolism
Module
apla_M00009  Citrate cycle (TCA cycle, Krebs cycle)
apla_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
apla_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101792265 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101792265 (SDHA)
Enzymes [BR:apla01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101792265 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 101792265
NCBI-ProteinID: XP_005024960
Ensembl: ENSAPLG00000007028
LinkDB All DBs
Position
Un
AA seq 683 aa AA seqDB search
MVITVAGRDKYNPKMQQSEHWKSFLWKHLVYNSCPDFFPQWPAACQTLARNLHFTVYGKK
HASTKVSDSISTQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTV
AAQGGINAALGNMEDDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVIELENYGMPFS
RTEEGKIYQRAFGGQSLQFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFA
LDLLMENGECRGVIALCIEDGSIHRFRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVT
RAGLPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRD
VVSRSMTIEIREGRGCGPEKDHVYLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIP
VLPTVHYNMGGIPTNYKGQVITHVNGEDKVVPGLYACGEAASASVHGANRLGANSLLDLV
VFGRACALTIAETCKPGEPVPSIKPDAGEASVANLDKLRFANGTIRTSEVRLNMQKTMQS
HAAVFRTGSVLQEGCEKLSQIYSDLAHLKTFDRGIVWNTDLVETLELQNLMLCALQTIYG
AEARKESRGAHAREDYKVRIDEFDYSKPLQGQQRKPFEEHWRKHTLSYVDVKSGKVSLKY
RPVIDKTLNEEDCSTVPPAIRSY
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggttataacagttgctggaagagacaaatacaatccaaaaatgcagcagagtgaacac
tggaaatctttcttgtggaaacatttggtctacaacagttgtcctgatttcttcccacag
tggccagcggcgtgccagactcttgcacgcaacttgcacttcacagtctatggaaagaaa
cacgcttctacgaaggtttctgattcgatttccacgcagtatccagtagtggaccatgag
ttcgacgcggttgttgtgggtgctgggggagcaggcctgcgggctgcatttggtttgtca
gaggctggctttaacacggcgtgcgttacaaagctgttccccaccaggtctcatactgtt
gctgcacagggagggatcaatgcagctctgggaaacatggaggacgataactggaggtgg
catttctacgacacagtgaaaggctccgactggctgggtgaccaggatgccatacactac
atgacggagcaagccccggctgccgtgatagagctggagaattacgggatgccattcagt
agaacagaagaaggaaaaatctaccaacgtgcatttggtggacagagccttcagtttgga
aaaggaggacaggcccacaggtgctgctgtgttgcagaccggacaggacactcgctgttg
catactctgtatggcaggtctctaagatatgataccagctactttgttgaatattttgcc
ttggacctgctcatggaaaatggagagtgtcgtggtgttattgccctttgcatagaagat
ggttctatacatcgttttagagcaaagaacactgttattgccactggagggtatggccgc
acttatttcagttgcacatcagctcatacaagtacaggtgatggcactgctatggtcaca
cgagctggccttccttgccaggacttggagttcgtacagtttcaccctacaggtatctat
ggggctggctgccttataacagaagggtgtcgaggagagggaggtattctcattaacagt
caaggtgaaagattcatggagagatacgcacctgttgctaaagatctggcttccagggat
gtcgtgtctcgttctatgaccatagagatacgggaaggaaggggctgtggccctgaaaaa
gaccatgtgtatttgcagctgcaccatttaccaccacagcagctggcaactcgtctccca
ggaatttcagaaacagctatgatatttgctggagtcgatgtcactaaagagcctattcct
gttctgcccactgtgcattataatatgggtggtattcctacaaactacaaaggacaggtg
attacacatgtgaatggtgaggataaagtggtacctggcctatatgcctgtggggaagca
gcatctgcgtctgtccatggtgcaaacagactcggagcaaactcccttctggatttggtg
gtctttggccgtgcttgtgcccttacaattgcagaaacgtgcaagcctggagagccagtt
ccttccattaaaccagatgctggtgaagcatcagttgctaatcttgacaaattaagattt
gctaatggaaccataagaacttcagaagtgcgacttaacatgcagaagacaatgcaaagc
catgcagctgtgtttcgtactggctctgtactacaagagggctgtgaaaaacttagccag
atttatagtgatctggctcacctaaagacatttgacagaggtattgtgtggaacactgac
ttggtggagaccctggaactgcaaaacctgatgctttgtgctctacaaaccatttatggt
gctgaggctcgcaaggagtcccggggtgctcatgccagagaggactataaggtacggata
gatgagtttgactattccaagccactccaaggccaacagcgcaagccatttgaagagcac
tggagaaagcacaccctttcgtatgtggatgtcaagtctgggaaggtttccttgaaatac
agacctgtaattgacaaaactttgaatgaagaagactgctcgactgttcctcctgctatt
cgctcatactag

DBGET integrated database retrieval system