KEGG   Anas platyrhynchos (mallard): 101793072Help
Entry
101793072         CDS       T02816                                 

Gene name
MBD4
Definition
(RefSeq) methyl-CpG-binding domain protein 4 isoform X1
  KO
K10801  methyl-CpG-binding domain protein 4 [EC:3.2.2.-]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:apla00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    101793072 (MBD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:apla03036]
    101793072 (MBD4)
   03400 DNA repair and recombination proteins [BR:apla03400]
    101793072 (MBD4)
Enzymes [BR:apla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     101793072 (MBD4)
Chromosome and associated proteins [BR:apla03036]
 Eukaryotic type
  Heterochromatin formation proteins
   MBPs (metylated DNA binding proteins)
    101793072 (MBD4)
DNA repair and recombination proteins [BR:apla03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     101793072 (MBD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HhH-GPD
Motif
Other DBs
NCBI-GeneID: 101793072
NCBI-ProteinID: XP_012948006
LinkDB All DBs
Position
13
AA seq 234 aa AA seqDB search
MSNGSVTVRNRACSRARHEEPIPRTQVERRKTSPYFSSKYSKEAPSPPRRKALRKWTPPR
SPFNLVQETLFHDPWKLLIATIFLNKTSGKMAIPVLWEFLEKYPSPEVARTADWKEMAEL
LKPLGLYALRAKTIIKFSDEYLTKQWKYPIELHGIGKYGNDSYRIFCVNEWKEVRGAAVL
PGLGLGCAAGGGWESVLSVGLLCMYSLGLKNQSDFSSEENWLNSLSVLFTSLSL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgggtccgttactgtgcgaaaccgggcctgcagccgggcaagacacgaagag
cctatcccccgaacacaggtggagaggaggaaaacaagcccgtatttctcaagtaaatac
agtaaggaagctccaagcccgcctcgaaggaaggcgctcagaaaatggactcctccgcgt
tctccttttaacttggtccaagaaacgcttttccatgatccgtggaagctgctcattgca
accatatttctcaataagacgtcaggtaaaatggcgattcctgtgctctgggagttcctt
gagaagtacccttctcctgaagtagccagaaccgcggactggaaggaaatggcagagctg
ttgaaacctctcggcctctacgcactcagagcgaaaaccataatcaaattttcagatgag
tacctgaccaagcagtggaagtaccccattgagctgcacggaattgggaaatacgggaac
gactcctacaggatcttctgcgtcaacgaatggaaagaggtgcgtggtgctgctgttctg
ccggggcttgggctggggtgtgctgcaggtggtgggtgggagtctgtcctgtctgtggga
cttctatgtatgtactcgcttggactgaaaaatcagagcgatttttcttctgaagagaat
tggttgaactccctgagtgtactctttacaagtctgagcctttaa

DBGET integrated database retrieval system