KEGG   Anas platyrhynchos (mallard): 101793275Help
Entry
101793275         CDS       T02816                                 

Gene name
ALDH7A1
Definition
(RefSeq) aldehyde dehydrogenase 7 family member A1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla01100  Metabolic pathways
Module
apla_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101793275 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    101793275 (ALDH7A1)
   00620 Pyruvate metabolism
    101793275 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101793275 (ALDH7A1)
   00561 Glycerolipid metabolism
    101793275 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    101793275 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    101793275 (ALDH7A1)
   00310 Lysine degradation
    101793275 (ALDH7A1)
   00330 Arginine and proline metabolism
    101793275 (ALDH7A1)
   00340 Histidine metabolism
    101793275 (ALDH7A1)
   00380 Tryptophan metabolism
    101793275 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101793275 (ALDH7A1)
Enzymes [BR:apla01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     101793275 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     101793275 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     101793275 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-GeneID: 101793275
NCBI-ProteinID: XP_005015424
Ensembl: ENSAPLG00000012964
LinkDB All DBs
Position
Un
AA seq 483 aa AA seqDB search
MSRQRQRAGMAVLLAVLLLRTDDYEETVKKAKEAWKVWADIPAPKRGEIVRQIGDALRQK
IKVLGSLVSLEMGKIYVEGVGEVQEYVDVCDYAVGLSRMIGGPILPSERPGHALIEQWNP
VGLVGIITAFNFPVAVYGWNSAIAMICGNACLWKGAPTTSLISVAVTKIIAKVLEDNKIP
GAICSLVCGGADIGTAMARDERMDLLSFTGSTKVGKQVALMVQERFGRSLLELGGNNAII
VFEDADLNLVIPSALFAAVGTAGQRCTTARRLFLHESIHDVVVEKLAKAYAQVRIGDPWD
SDTLYGPLHTKEAVKMFLDAVEQAKQQGGSVVCGGKVINRPGNYXXXXXXNYVEPTIVTG
LPHNAPIVHTETFAPILYVLKFKEEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGS
DCGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDSWKLYMRRSTCTINYSKDLPLAQGI
KFQ
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaggcagcggcagagagcaggcatggctgttctcttggctgtgctccttctccgg
acagatgactatgaagaaacagtaaagaaggctaaagaggcatggaaagtctgggctgat
atccctgcaccaaaacgtggagaaatagtacgacagattggcgatgccctgagacaaaaa
atcaaagttctaggaagcttggtctcattggaaatgggaaagatttatgtcgagggtgtt
ggggaagtgcaggagtatgttgatgtctgtgattatgctgttggtttgtcccgaatgatt
ggtggacctattttgccttcagaaagacctggccatgcacttatagagcagtggaatcct
gttggcttagttggaatcatcaccgccttcaacttccctgtcgcagtttatgggtggaac
agtgcaattgcaatgatctgtggaaatgcttgcctctggaaaggtgctcctacaacatcc
ctcatcagtgttgctgttacaaagataattgccaaagtcttggaggataacaaaatacct
ggagcaatctgttctctggtctgtggtggagcagacattgggacagcaatggcaagagat
gagagaatggacctgttgtccttcactggcagcacaaaagtgggcaaacaagtagcgctt
atggttcaggagagatttggccggagtctgctggaactgggaggaaacaacgccattatt
gtgtttgaagacgcagatctgaacctagtcatcccatctgctctatttgctgctgtggga
acggctggtcagaggtgcacaactgccagaagactgttcctccatgaaagcatccatgat
gtggtggtggaaaagcttgcaaaagcctatgcccaggtccgcattggtgatccatgggat
tctgacactctgtatgggcctcttcataccaaagaagcagtgaaaatgtttcttgatgca
gtagaacaagcaaaacaacaaggtggctctgtggtctgtggtggaaaggttataaatcgc
cctggaaactacgnnnnnnnnnnnnnnngaaactacgttgaaccaaccattgtgactggc
cttccacataatgcacccattgtacacactgagacatttgctcccatactgtatgtgctg
aaatttaaggaggaagaggaggtttttgcctggaataatgaagtaaaacaaggtctttcc
agcagtatctttaccaaggatttgggaaggattttccgatggcttgggccaaagggatct
gactgtggcattgtgaatgtcaatatcccaaccagtggggcagagattggtggtgctttt
ggtggtgaaaagcacactggtgggggaagagaatctggaagcgattcatggaaactttat
atgagacggtcaacttgtacaatcaactacagcaaggatttacctttggctcaaggaatc
aagtttcaataa

DBGET integrated database retrieval system