KEGG   Anas platyrhynchos (mallard): 101793783Help
Entry
101793783         CDS       T02816                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla05164  Influenza A
Brite
KEGG Orthology (KO) [BR:apla00001]
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    101793783 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:apla01002]
    101793783 (TMPRSS2)
Enzymes [BR:apla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     101793783 (TMPRSS2)
Peptidases [BR:apla01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101793783 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 DUF1986 Hepsin-SRCR SRCR Ldl_recept_a Trypsin_2 DUF3149
Motif
Other DBs
NCBI-GeneID: 101793783
NCBI-ProteinID: XP_021132301
Ensembl: ENSAPLG00000016160
LinkDB All DBs
Position
1
AA seq 482 aa AA seqDB search
MTSTVGPPPYFENHGFQPENYSARPPAGANPYPPYFSTNAPSVPTYVPRVSTYQSTSPVA
PSTGRTCSSGVKKTIIIIISIVIVICCAVGAFFIWYFVENPCLGSLECGSSGVCVPPSDW
CDGVTNCPNGEDENRCVRLFGPNFILEVYSPVSNTWYPVCQDNWTDDFGKIACKDIGYNV
DTYYSSSGVAAEVSFKSFMKLNTSAGSTDLYKRLYTSNVCTSGKVVSLRCIQCGLSTKST
AIMNRIVGGSAAALGQWPWQLSLHVQGTHVCGGSIITREWLVTAAHCVEGQLSDPYVWRV
YAGIVSQSDITLRAAYKVQQIISHPDYDTDTKDNDVALMKLETPLSFTDNVQPVCLPNAG
MTFQPNQQCWISGWGAESQGGKTSTNLNYVMVPLIERSKCNSIYIYNGLILPTMICAGYL
EGGIDSCQGDSGGPLVTNESSVWWLVGDTSWGSGCATPNRPGVYGNMTVFTDWIYKNMQA
NR
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgacctctactgtaggcccaccgccatactttgaaaatcatggctttcagccagaaaac
tattctgccaggccaccagcaggtgctaacccatatccaccatacttctctacaaatgct
ccatcagtgccaacctatgtcccaagagtttcaacctaccagtcgactagtccagtagcc
ccttcaactgggaggacttgttcatcaggtgtaaagaaaaccataataattataatatcc
attgtaatagtcatttgttgcgcagttggtgctttcttcatttggtattttgtagagaat
ccttgcctcggatcgttagagtgtgggtcttcaggagtgtgcgtgcctccctcagattgg
tgtgatggagtgaccaactgcccaaatggggaggatgaaaaccgttgtgttagacttttt
ggaccaaactttatccttgaagtttactcacctgtcagcaacacctggtatcctgtttgc
caagataactggactgatgattttggaaagattgcgtgtaaagatataggctataatgta
gatacatattacagtagttcaggagtagcagctgaagtcagctttaaaagctttatgaag
ctgaacacaagtgctgggagtacagacttgtataaaaggctatataccagcaatgtctgt
acatcaggaaaggtggtttctctacgctgcatacagtgcggcctgtccaccaaaagcaca
gccatcatgaacaggatcgtgggtggcagcgcagcagcgctggggcagtggccgtggcag
ctcagcctccacgtgcagggcacgcacgtctgtgggggctccatcatcacccgcgagtgg
ctggtgaccgcggctcactgcgtggagggacaactttctgacccatatgtttggagagtt
tatgctgggattgtgagccagagtgacattactttaagagctgcatataaagtgcaacaa
ataatttcccatccagattatgatacagacactaaagacaatgatgttgcccttatgaag
ttagagacaccgttgagttttactgataatgtacagccagtttgtctgcctaatgcagga
atgacattccagcccaatcagcagtgctggatatctggatggggagcagagtcccaagga
ggtaaaacatcaactaacttgaattatgtcatggtacctttaatagaacgttctaaatgt
aattctatctatatctataatggtctgattttgcctacaatgatctgtgctggatatcta
gaaggaggaattgattcctgtcagggtgacagcggaggtcctctggtaacaaatgaaagc
tccgtgtggtggttggttggagataccagctggggaagtggctgtgctactcccaataga
cctggagtttatgggaatatgactgtgtttacagactggatttataaaaatatgcaggca
aacagatga

DBGET integrated database retrieval system