KEGG   Anas platyrhynchos (mallard): 101793835Help
Entry
101793835         CDS       T02816                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1 isoform X1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00250  Alanine, aspartate and glutamate metabolism
apla00410  beta-Alanine metabolism
apla00430  Taurine and hypotaurine metabolism
apla00650  Butanoate metabolism
apla01100  Metabolic pathways
Module
apla_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    101793835 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101793835 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101793835 (GAD1)
   00430 Taurine and hypotaurine metabolism
    101793835 (GAD1)
Enzymes [BR:apla01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     101793835 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 DegT_DnrJ_EryC1 SepSecS OKR_DC_1 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 101793835
NCBI-ProteinID: XP_027317242
Ensembl: ENSAPLG00000005082
LinkDB All DBs
Position
7
AA seq 590 aa AA seqDB search
MASSAPSSSNDAPDPTPTNLRPTTYDSWCGVAHGCTRKIGLKICGFLQRTNSLEDKGRIV
SSLKERRSSKSLLACENSEKESRFRRTETDFSNLYARDLLPAKNGEEQTMQFLLEVVDIL
LNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDNPESLEQILVDCRDTLKYGVRTGH
PRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLRKMREIIGWSNKDG
DGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAALGFG
TDNVILIKCNERGKIIPADLEAKILEAKQKGYIPLFVNATAGTTVYGAFDPIQEIADICE
KYNLWLHVDAAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVLLQCSAILVREKGIL
QGCNQMCAGYLFQQDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQINKCL
ELAEYLYTKIKNREEFEMVFEGEPEHTNVCFWYIPPSLRGMPDCDERREKLHRVAPKIKA
LMMESGTTMVGYQPQGDKVNFFRMVISNPAATKSDIDFLIEEIERLGQEL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctccgctccctcgtcctccaacgacgctccggaccccaccccgactaattta
cgacccacaacctacgactcgtggtgtggcgtggcgcacgggtgcaccaggaagatcggg
ctgaagatatgcgggttcctgcaaaggaccaacagtctggaagacaagggccggatcgtg
agctccctgaaggaaaggcggtcctccaagagcctgctggcgtgtgagaacagcgagaag
gagtccaggttccggcgcaccgagacagacttctccaatttgtatgccagagatttgctg
cccgccaagaacggcgaggagcagaccatgcagttcctgctggaggtcgtggacatcctc
ctcaactacgtgaggaagacgtttgacaggtccaccaaagtgctggacttccaccacccg
caccagctcctggagggcatggagggcttcaacctggagctctcggacaaccccgagtcc
ctggagcagatcctggtggactgcagggacacgctcaagtacggggtgaggacaggtcat
ccgcgctttttcaatcagctctccacagggctggacatcattggcttggctggggagtgg
ctgacatcgactgcgaacacaaacatgtttacatatgaaattgcccctgtttttgtcctc
atggaacaaataacacttcgaaagatgagagagattattggatggtcgaataaagatggc
gatggaatattctcacctggaggagctatttccaacatgtacagcataatggccgcacgc
tacaaatatttccctgaagtcaaaaccaaaggcatggctgcagtccctaaactggttctc
tttacctcagaacatagtcattactcaataaagaaagctggagctgcacttggatttgga
acagacaacgtgattttgataaaatgcaatgaaagaggcaaaataataccagctgatttg
gaagcaaaaattttggaagcgaaacaaaagggatacattcctctctttgtaaatgcaacc
gcaggcacaacagtatatggagcctttgatccaatacaggagattgcagatatatgtgaa
aaatacaacctctggctccatgtagatgctgcttggggaggtggactcttaatgtcccga
aagcatcgtcataaattgaatggaatagaaagagccaattcagtcacttggaatccacac
aagatgatgggagtattgttgcaatgttccgccattctggtccgggagaagggtatactt
caaggctgcaatcaaatgtgtgcaggatatctcttccagcaagacaaacagtacgatgta
tcctatgacactggagataaggcaatacagtgtggtagacatgtggacattttcaaattc
tggttgatgtggaaagcaaagggtacagtaggatttgaaaatcagatcaacaaatgcctg
gaactggcagaatatctctatactaaaatcaaaaacagagaagaatttgaaatggttttt
gaaggagagccagagcatacaaacgtatgtttttggtatattccaccaagtctcaggggc
atgccagactgcgatgagagacgagaaaagttacacagggtggcaccaaaaatcaaagca
ctgatgatggagtcaggtactaccatggttggatatcagccacagggtgacaaagtcaac
ttcttccgaatggtcatctcaaatccagcagcaacgaagtctgacatagacttcctcatt
gaggaaatagagagactggggcaggagctgtag

DBGET integrated database retrieval system