KEGG   Anas platyrhynchos (mallard): 101793933Help
Entry
101793933         CDS       T02816                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial isoform X1
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00020  Citrate cycle (TCA cycle)
apla00190  Oxidative phosphorylation
apla01100  Metabolic pathways
apla01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101793933 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101793933 (SDHB)
Enzymes [BR:apla01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101793933 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer2 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 101793933
NCBI-ProteinID: XP_027298969
Ensembl: ENSAPLG00000015023
LinkDB All DBs
Position
22
AA seq 313 aa AA seqDB search
MAAAVVGVSLRRGVPARLLRAGPRPLSPRSAQPGDVLLPAKSRPEGPKGPSAAVHMQICR
GAQTAAAAAPRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTL
TFRRSCREGICGSCAMNIAGGNTLACTKRIDPDLGKITKIYPLPHMYVVKDLVPDLSNFY
AQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYL
GPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIK
KMMATYKEKAAAA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccgtggtgggagtctccttgaggcgcggcgtccccgcgcggctcctgcgg
gccgggcccaggccgctctcgccccgaagcgcacagcctggagacgttttgttgccggct
aaaagccgcccagagggacctaagggcccttctgctgctgttcacatgcagatctgtcgg
ggagcacagacagctgctgcggccgcgccacgcatcaagaagttttccatctacagatgg
gatcccgataagcctggggacaagccccgcatgcagacgtacgaggtggatttgaataaa
tgtgggcccatggtactcgatgctctgatcaagattaaaaacgagttggactccactctg
accttccgcaggtcatgcagggaaggcatctgtggctcttgtgctatgaacattgctggc
ggaaacaccctggcctgcaccaaaagaattgaccctgatctgggcaagatcactaaaatc
taccctctcccccacatgtatgtggtgaaggatcttgttccggacttgagtaacttctat
gcacagtataaatccattgagccttacctgaagaagaaggatgagtcgaaacagggcaag
gagcagtacctgcagtccatagaagaccgtcagaaactggacggactctacgagtgcatc
ctgtgtgcctgctgcagcaccagctgtcccagttactggtggaacggggacaagtacctg
ggtcctgcagtactgatgcaggcctatcgctggatgattgactccagggatgactacaca
gaggaacgcctggcacaacttcaagacccgttttctctctaccgttgtcacactatcatg
aattgcacaagaacttgcccaaagggtttgaaccctggcaaagcaattgctgagatcaag
aagatgatggcaacttacaaagagaaggcagccgctgcgtaa

DBGET integrated database retrieval system