KEGG   Anas platyrhynchos (mallard): 101794107Help
Entry
101794107         CDS       T02816                                 

Gene name
HK1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00010  Glycolysis / Gluconeogenesis
apla00051  Fructose and mannose metabolism
apla00052  Galactose metabolism
apla00500  Starch and sucrose metabolism
apla00520  Amino sugar and nucleotide sugar metabolism
apla01100  Metabolic pathways
apla01200  Carbon metabolism
apla04910  Insulin signaling pathway
Module
apla_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
apla_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101794107 (HK1)
   00051 Fructose and mannose metabolism
    101794107 (HK1)
   00052 Galactose metabolism
    101794107 (HK1)
   00500 Starch and sucrose metabolism
    101794107 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    101794107 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101794107 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101794107 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:apla04131]
    101794107 (HK1)
Enzymes [BR:apla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     101794107 (HK1)
Membrane trafficking [BR:apla04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    101794107 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 101794107
NCBI-ProteinID: XP_005009142
Ensembl: ENSAPLG00000009913
LinkDB All DBs
Position
Un
AA seq 925 aa AA seqDB search
MARGALAMATWKEPNALDVPGYCCSPLCPIDKYLYAMRLSDETLIDIMARFRREMKNGLS
RDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSYFRILRVKVSHEKKQTVQMESEIY
NTPEDIMHGSGTRLFDHVAECLGDFMEKQQIKDKKLPVGFTFSFPCRQSKLDEGVLITWT
KRFKASGVEGADVVKLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGLIIGT
GTNACYMEEMRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQL
FEKMVSGLYMGELVRLILVKMAKEGLLFEGRITPELLTKGKFETKHVSAIEKSKEGLNKA
KEILTRLGVEPSHEDCVAVQHVCTIVSFRSANLVASTLGAILNQLRDNKGVGRLRTTVGV
DGSLYKMHPQYARRLHKTTRRLVPDSDVRFLLSESGSGKGAAMVTAAARXXXEQHRLIDE
TLAEFKLTHEQLLQVKKRMRTEMEAGLKKKSHETAKVKMLPTFVRSTPDGTENGDFLALD
LGGTNFRVLLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVTCISDFLDYMGIK
GARLPLGFTFSFPCKQTSLDAGILLNWTKGFKATDCEGEDVVYLLREGIKRREEFDLDVV
AVVNDTVGTMMTCAYEDPNCEIGLIVGTGSNACYMEEMRNVEMVDGEQGRMCVNMEWGAF
GDNGCLDDIRTIYDKAVDDFSLNAGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQI
SETLKTRHIFETKFLSQIESDRLALLQVRTILQQLGLNSTCDDSIIVKTVCGAVSKRAAQ
LCGAGMAAVVDKIRENRGLEHLEITVGVDGTLYKLHPHFSRIMHQTVKDLAPKCDVTFLL
SEDGSGKGAALITAVGCRLRDAEQN
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaggtgctctcgctatggctacatggaaggagccgaatgccctggatgtgcct
ggctactgctgctccccgctgtgcccaattgataaatacctttacgccatgcggctctcc
gacgaaacgctgattgacattatggctcgcttcaggagggagatgaagaacggcctctcc
cgagacttcaaccccacggccacggtgaaaatgcttcccactttcgtgaggtccatccct
gacggctcagagaaaggagatttcattgctctggatcttggtggttcttactttcgcatt
ctgcgggtgaaagtgtcgcacgaaaagaagcagacggtacaaatggaaagcgaaatctat
aacacacctgaagatatcatgcacggcagcgggacacggctttttgatcatgttgctgaa
tgcctgggagacttcatggagaaacaacaaatcaaagacaagaagttacccgttgggttt
acgttctctttcccgtgccgacaatccaagctagatgagggtgttctgataacctggacg
aagcgcttcaaagcaagcggagtggagggagcagacgttgtgaagctgcttaacaaggcc
atcaagaaacgtggggactacgatgcagacatcatggctgttgtgaacgatactgtcggg
acgatgatgacctgcggcttcgatgaccagcgttgtgaagttggcttgatcattggcact
ggcaccaacgcctgttacatggaggagatgcggcacatagacctggtggaaggggacgag
ggcaggatgtgcattaacacggagtggggggccttcggagatgacggttcactagaggac
atcaggaccgagttcgacagagagatcgaccgcggatccctaaatcctgggaagcagctg
tttgagaagatggtcagcgggctgtacatgggggagctggtgaggctcatcctggtgaag
atggccaaggaggggctgctctttgaagggagaatcacccccgagcttctcaccaaaggg
aagtttgagacaaagcatgtttctgccatagaaaagagcaaagaaggtttgaacaaagcc
aaagaaatcctaacccgcctgggggtggagccgtcccacgaggactgtgtggcggtccag
cacgtctgcaccatcgtgtccttccgctcggccaacctggtggcctccacgctgggcgcc
atcctcaaccagctgcgagacaacaagggggtcggccgcctccgcaccaccgtgggggtc
gatggctccctctacaagatgcacccacagtacgctcggcgcttgcacaaaaccacccgg
cgcctggtgcccgactcggacgtgcggttcctgctgtcagagagcggcagcgggaagggg
gcagcgatggtgacggcggcggcgcggcnnnnnnnngagcagcaccggctgatcgacgag
acgctggctgagttcaagctcacccacgagcagctgctgcaggtgaagaagaggatgagg
acggagatggaagcgggcctgaagaagaagagtcacgagactgccaaagtgaagatgctg
cccaccttcgtccgcagcacgccggatgggacagagaacggtgactttctggcacttgac
cttggagggacaaactttagagttttgctggtgaaaattcgcagtggtaaaaggagaaca
gtagaaatgcacaacaagatctatgcaattcctatagaggtgatgcagggaacgggagaa
gagctgtttgatcacatcgttacctgcatttctgacttcctggattatatgggaataaaa
ggtgcacggcttcctctcggcttcacgttttccttcccttgcaagcagaccagtctagat
gctggtatcctcctcaactggacaaaaggcttcaaggctacagactgtgagggagaagac
gtggtgtatttgcttagagaaggaattaaaagaagagaggagtttgacttagatgtggtg
gctgtggtgaacgatacggtgggcacgatgatgacttgtgcttatgaagacccaaactgt
gaaattggactcattgtgggaactggcagcaacgcctgctacatggaagagatgagaaac
gtagagatggtggatggtgagcaaggacggatgtgtgtgaacatggagtggggagcgttc
ggggataatggatgcctggacgatatcaggacgatatatgacaaagcggttgatgacttt
tcactaaatgctggaaagcaaaggtatgagaaaatgatcagtgggatgtacctgggggaa
atagtccgcaatattctgatcgacttcaccaagcgggggttcctgttcagaggccagatt
tcagagacgttgaagaccaggcatatctttgaaaccaagttcctttcacagatcgagagc
gacaggttagctttgcttcaggtgcgaaccatcctccagcagctggggctcaacagcacc
tgcgacgacagcatcatcgtcaagaccgtgtgtggagcagtgtcgaagcgagcagctcag
ttgtgcggggctggcatggctgcagttgtagataaaattcgggagaacagaggattagag
cacctggagattacggttggtgtggacgggacgctgtacaagctacacccacacttttcg
aggattatgcaccaaacagtcaaagacctggcacccaagtgcgatgtgaccttcctgctt
tcggaagacggcagtgggaaaggggcagcgctcatcacggcggtgggatgcaggcttcgt
gatgccgagcagaactga

DBGET integrated database retrieval system