KEGG   Anas platyrhynchos (mallard): 101794210
Entry
101794210         CDS       T02816                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X2
  KO
K18496  fibroblast growth factor 1
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla04010  MAPK signaling pathway
apla04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:apla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101794210 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101794210 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:apla04052]
    101794210 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:apla00536]
    101794210 (FGF1)
Cytokines and growth factors [BR:apla04052]
 Growth factors
  Growth factors (RTK binding)
   101794210 (FGF1)
Glycosaminoglycan binding proteins [BR:apla00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   101794210 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 101794210
NCBI-ProteinID: XP_012957812
LinkDB
Position
14
AA seq 154 aa
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGKVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTKSGQYLAMDTNGLLYGSLLGEECLFLERLEENHYNTYVSKKHADKN
WFVGLKKNGNSKLGPRTHYGQKAILFLPLPVSAD
NT seq 465 nt   +upstreamnt  +downstreamnt
atggccgagggggagatcaccacgttcaccgccctgaccgagaagttcaacctgcccccg
gggaactacaagaagcccaagctcctgtactgcagcaacgggggccacttcctacggatc
cttcccgacggcaaggtggacgggacgcgggaccgaagcgaccagcacattcagctccag
ctcagcgcggaaagcgtgggtgaggtttatataaagagcaccaagtctgggcagtacctg
gcaatggacaccaacgggctcttgtacggctcgctactgggcgaggagtgcctgttcctg
gagcggctggaggagaaccattacaacacctacgtctccaagaagcacgccgataagaac
tggttcgtcggtctgaagaagaacgggaacagcaagctgggaccacggactcactacggg
cagaaggcgatcctcttcctcccgctgcccgtgtcggccgactga

DBGET integrated database retrieval system