KEGG   Anas platyrhynchos (mallard): 101794253Help
Entry
101794253         CDS       T02816                                 

Gene name
GANC
Definition
(RefSeq) glucosidase alpha, neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00052  Galactose metabolism
apla00500  Starch and sucrose metabolism
apla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101794253 (GANC)
   00500 Starch and sucrose metabolism
    101794253 (GANC)
Enzymes [BR:apla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101794253 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 NtCtMGAM_N DUF5110 POC3_POC4
Motif
Other DBs
NCBI-GeneID: 101794253
NCBI-ProteinID: XP_005021743
Ensembl: ENSAPLG00000015065
UniProt: U3J628
LinkDB All DBs
Position
Un
AA seq 911 aa AA seqDB search
MFSALSSVQDEAVDKSNFKECNQIAFYRRQKLLRPGKSLYRALLDSVTLSDENVKFQIIH
EENKVLLQVEIYEIEGNIFRIKINEAAPLRARYEVPDVLIKEPTTQRLSVSQKEAGILVL
TSVNKDYTLQVTANPFQVELHSKGETVLSMNSNGLLYFEHLQPPPSDRKSTAENEEAASD
SSKEKQEDLGLWQEKFGSFLDFKAHGPSSVGVDFSLHGFDHVYGIPQHAESLLLKNTSDG
DAYRLYNLDIFGHKIHEKIGIYGSVPLLLAHKPNRTSGIFWLNSSETLVDINTKAVAEHI
QSGSAADTAKQRAVPLTDVRWMSESGIIDVFLLMGPTAFDIFKQFAQLTGTQALPPLFSL
GYHQCRWNYEDEQDVKAVDAGFDEHDIPYDVIWLDIEHTDGKRYFTWDKKKFQNPKRMQE
LLRKKKRKLVVIVDPHIKVDPMYALYSQGKDKGYFVKDRNGQDFEGICWPGSSCYLDFTN
PEVRKWYADQFAFKTYKGSTNILFVWNDMNEPSVFKGAELTMQKDAVHYKNWEHRELHNL
YGFYQQMATAEGLIKRSSGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWGYLKISIPMLL
TISLAGISFCGADVGGFIGDPEPELLVRWYQAGAYQPFFRGHSNMESKRREPWLFGEKNT
QIIREAIRERYVLLPYLYTLFYRAHTVAEPVMRPLWVEFPGKLETFGVENEYMLGNALLV
HPVTDKEAKAVSVLLPGSEEIWYDFRTFIRMEDPGTLKIPVTLDNIPVFQRGGTVIPLKT
TAGKSTEWMIDVSYELHVALDTEARAIGELYLDDGHSFQYLHKKQFLYRKFTFHKNILSS
SCMCESGQYHTTCVVERVVFLGVGQQPTSVSVCSKDGKEKEVVFTYDTKTSVLMLENLAL
SIDADWKICVK
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atgttttctgctctttctagtgttcaagatgaagctgtggacaaaagcaactttaaggaa
tgcaaccagattgctttttacaggcgtcagaaacttctacgtcctggaaaatccttgtat
cgagcattgctggattcagtcacattaagtgatgagaatgtcaaattccaaattattcat
gaggagaataaggttcttctacaagtagaaatatatgaaatagaaggcaatatttttagg
attaaaattaatgaggcagctcctctcagagcaagatacgaagttcctgatgttcttata
aaggaacctaccacccagagactctctgtatcccagaaggaggcaggtattttggtgctg
acaagtgttaataaggactacacgcttcaagtcacagcaaaccccttccaggttgagcta
cactccaagggtgagactgttctgagcatgaattccaatgggttgttatattttgagcac
ctccaaccacctcctagtgatagaaaatctacagcagaaaacgaggaggcagcaagtgat
tcttctaaggagaaacaggaggatctaggtctctggcaagagaaatttggcagtttcttg
gatttcaaagctcatggtccaagttctgtaggtgtggacttctctttacatggatttgac
catgtctatggaataccacaacacgcagaatcactacttctcaaaaacacaagtgatggt
gatgcctaccggctttataatttggacatcttcggacacaagatacatgaaaaaataggt
atttatggttcagtgccccttctcttagcacacaagcctaacagaacttcagggattttc
tggctgaactcttcagaaacactggtggatattaatacaaaggcagtagctgagcacata
cagtccggatctgctgcagatactgctaagcagagggcagtgcctctaactgatgtgcgc
tggatgtcagaaagtgggatcattgatgttttcctgctgatgggaccaactgcatttgat
atcttcaaacaatttgcacaactgacaggcactcaagccctacctccccttttttctctg
ggctaccatcagtgccgctggaattatgaagatgagcaagatgtcaaggcagtagatgca
ggttttgatgaacatgacattccatacgatgtgatatggctggacatagaacacacagat
gggaagaggtattttacgtgggacaagaagaaattccagaaccccaagaggatgcaggaa
cttctcaggaagaaaaaacgcaagcttgtcgtcattgtagacccccacattaaagtggat
cccatgtatgccctgtattcacaaggaaaagacaagggatattttgtgaaagacagaaat
ggacaagattttgagggcatctgttggccaggttcgtcttgttacctagatttcaccaat
cctgaagtgcgaaaatggtatgcagatcaatttgccttcaaaacatacaaggggtccact
aatatcctctttgtgtggaatgacatgaatgagccatcagttttcaaaggagcagagcta
acaatgcagaaagatgctgtgcactacaagaactgggagcaccgggaattgcacaacctc
tatggattctaccagcaaatggcgactgcagaaggactcatcaaacgatcttcaggaaag
gaaagaccatttgttctcacacgatcgttctttgctgggtcacagaagtatggggcagtg
tggactggagacaacacagcagagtggggttacttgaaaatctccattccaatgcttttg
accatcagcctggcagggatttcattctgtggagctgatgtgggagggttcattggagac
ccagaaccagaattgcttgttcgatggtatcaggctggagcctaccagcccttcttcaga
ggtcactctaacatggagagcaaacggcgagaaccgtggctctttggggagaagaacacc
cagatcatcagggaagccattagagagcgctacgtcctcctgccatacttatacacactg
ttctatcgggcacacacagtggctgaaccagttatgaggcctctctgggtagagtttcca
gggaaattagaaacttttggtgtggaaaatgagtatatgctaggaaatgctctgttggtg
catccagtcacggacaaagaggccaaggcagtgagtgttctgcttccagggtcagaggag
atttggtatgatttcagaacatttatacgaatggaagatccaggcactctgaagatccca
gtaacactggacaacattcctgtattccagcgaggaggcactgtgatacctcttaagact
acagctggaaaatccactgaatggatgatagatgtttcttatgaactccatgtggccctg
gacacagaggcccgtgcaataggtgagctctacctagatgacggacattcatttcagtac
ctccacaagaagcagttcctgtaccggaaattcactttccacaagaacattctgtcttcc
agctgcatgtgcgaaagtggacaataccacaccacatgtgtagttgaacgggtggtattt
ctgggagttggacaacaacccacttctgtatcagtctgttccaaggatgggaaagaaaaa
gaagtggttttcacatacgatacgaagacctctgtgctgatgctggaaaatttagccctg
agcattgatgctgactggaagatttgtgtcaagtga

DBGET integrated database retrieval system