KEGG   Anas platyrhynchos (mallard): 101794925
Entry
101794925         CDS       T02816                                 

Gene name
IL-2
Definition
(RefSeq) interleukin-2 precursor
  KO
K05429  interleukin 2
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla04060  Cytokine-cytokine receptor interaction
apla04625  C-type lectin receptor signaling pathway
apla04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:apla00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101794925 (IL-2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101794925 (IL-2)
   04672 Intestinal immune network for IgA production
    101794925 (IL-2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:apla04052]
    101794925 (IL-2)
   00536 Glycosaminoglycan binding proteins [BR:apla00536]
    101794925 (IL-2)
Cytokines and growth factors [BR:apla04052]
 Cytokines
  Interleukins
   101794925 (IL-2)
Glycosaminoglycan binding proteins [BR:apla00536]
 Heparan sulfate / Haparin
  Cytokines
   101794925 (IL-2)
SSDB
Motif
Pfam: IL15 NUC173
Other DBs
NCBI-GeneID: 101794925
NCBI-ProteinID: NP_001297302
Ensembl: ENSAPLG00000006840
UniProt: Q8JFF4
LinkDB
Position
4
AA seq 140 aa
MCKVLIFSCLSVLMLMTTAYGAPLSEKDNTLKTLIKDLENLGTSMNGIDLELYTPNDTKE
CSWQTLQCYLKEIVTLEEEIEDEDEIEDEKVSSVRNIKMNLQKLMDLIPPGTGCNICEAN
ANNFPEFRQELTNFLRSMLK
NT seq 423 nt   +upstreamnt  +downstreamnt
atgtgcaaagtactcatcttcagctgcctttcagtactaatgcttatgactacagcttat
ggagcacctctatcagagaaagacaacactcttaaaactttaataaaagatttagaaaac
ctgggaacaagcatgaatgggattgatcttgagctctacacaccaaatgacacaaaggag
tgcagctggcaaactctgcaatgttacttgaaagaaatagtcaccttggaggaagaaatt
gaagatgaggatgaaattgaagatgagaaggtatctagtgttcggaatatcaaaatgaat
ctccaaaaacttatggacctaattcccccaggaacgggatgcaatatctgtgaagctaat
gccaacaacttccctgaatttcgccaagagctgaccaacttcctgagatctatgctaaaa
taa

DBGET integrated database retrieval system