KEGG   Anas platyrhynchos (mallard): 101795011Help
Entry
101795011         CDS       T02816                                 

Gene name
GYS2
Definition
(RefSeq) glycogen [starch] synthase, liver isoform X1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00500  Starch and sucrose metabolism
apla01100  Metabolic pathways
apla04910  Insulin signaling pathway
Module
apla_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101795011 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101795011 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:apla01003]
    101795011 (GYS2)
Enzymes [BR:apla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     101795011 (GYS2)
Glycosyltransferases [BR:apla01003]
 Polysaccharide
  Storage polysaccharide
   101795011 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 101795011
NCBI-ProteinID: XP_012958399
Ensembl: ENSAPLG00000016252
UniProt: R0LET4
LinkDB All DBs
Position
1
AA seq 704 aa AA seqDB search
MPLARSLSMTSLNGLPQWEDEDLPVEDLLLFEVSWEVTNKVGGIYTVIQTKAKITADEWG
ENYFLIGPYFEHNVKTQVEACEPPNPAVKKAMDIMKSQGCQVFFGRWLIEGSPYVLLFDI
GSAAWNLDRWKGEFWDVSNIGIPFHDREANDAVIFGSLTACFLKELSSQFDDKPNIIAHF
HEWQAGVGLILSRSQKLPVATIFTTHATLLGRYLCAASIDFYNNLDQFDIDKEAGERQIY
HRYCMERASVHCAHVFTTVSQITAIEAEHMLKRNPDVVTPNGLNIKKFSAMHEFQNLHSM
YKARIQEFIRGHFYGHLDFSLEKTLFFFIAGRYEFSNKGADMFLEALSRLNFLLRVHKSD
VTVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTAQSVKEKFGKKLYNALLKGEIPDLNKI
LDRDDITIMKRAIFSTQRHCLPPVTTHNMIDDGNDPILNTIRRIGLFNNRTDRVKVILHP
EFLSSTSPLLPLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQ
EHVADPAAYGIYIVDRRFRSPDESCNQLTQFLYGFCQQSRRQRIIQRNRTERLSDLLDWR
YLGRYYMHARHLALSRTFPDKFEMEPSAPPKTEGFRYPRPSSVPPSPSVSQHSSPHHSEG
EDEDEDERYDEDEEAERDRQNIKSPFSLGVLPQGKTKQHGEYRN
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgccactggctagatcactctctatgacctctcttaatgggcttcctcagtgggaggat
gaagacctaccagtggaagatttgttgctctttgaagtttcttgggaagttaccaacaaa
gtgggaggcatttacactgtgatccagacaaaagccaaaattacagcagatgaatggggt
gaaaactattttctgattggtccctattttgagcacaatgtgaagactcaggtggaagca
tgtgagcctccaaacccagcagttaagaaggcaatggacatcatgaaaagccaagggtgt
caggtcttttttggaagatggctgatagaaggcagtccatatgtcttgttgtttgatata
ggatcagcagcctggaatttggatagatggaaaggtgaattttgggatgttagcaacatt
gggatcccttttcatgaccgagaagccaatgatgctgtgatttttggatcattaacagcc
tgttttttaaaagagctttcctctcagtttgatgacaagcccaacataattgctcacttc
catgaatggcaggcaggagtgggtttaatactgtctcgatctcagaaacttcctgttgcc
acaatttttactacccatgccactcttcttgggagatacctgtgtgcagccagtatagat
ttttacaacaaccttgaccagtttgacattgacaaagaagcaggagaaagacagatttac
catcggtattgtatggaacgggcatctgtacattgtgcccatgtgttcaccacagtctca
cagataacggctatagaagcagaacacatgcttaaaagaaatcctgatgttgtcacccca
aatggcttgaacattaagaaattttcagcaatgcatgagtttcagaatttgcattccatg
tacaaggctaggatccaagagttcattcgaggtcatttctatggccaccttgacttcagt
cttgaaaagacattatttttcttcattgctgggagatatgaattttccaacaagggagct
gatatgtttctagaagccttatcaagattaaactttttgctgagggtacataagagtgat
gttacagttgttgtgttcttcattatgccagcaaagacaaacaatttcaatgtggaaacc
ctgaaaggacaagcagtccggaagcagctctgggacactgcacaatctgtgaaagaaaag
tttggaaagaaactctacaatgccttgctaaaaggagaaattccagacttgaacaagatt
cttgaccgggatgatataaccattatgaaaagagccatcttttcaactcagcgacattgt
ctgcctccagtgaccacccacaacatgattgacgatggcaatgatccaatcctcaatacc
attcgacgcattggccttttcaataaccggacagacagagtaaaggtgatcctacatcca
gaatttctttcttcaaccagcccattgctgcccttggactatgaggagtttgttagaggc
tgtcacctgggtgtgtttccatcatactatgaaccctggggttacactccagctgaatgt
actgtgatgggcattcccagtgtgaccacaaacctttctggattcggctgttttatgcag
gaacatgttgctgacccagctgcttatgggatctacatagttgacaggaggttccgctca
cctgatgaatcgtgcaaccagctgactcagttcctatatggattttgtcagcagtcccgt
cgccagaggatcatccaaagaaaccgaactgagaggctttcagatctgttggactggaga
tacctaggcaggtattacatgcatgccagacacttggccctcagcagaacatttcctgat
aaatttgagatggaaccaagtgctccaccaaagacggaaggtttcaggtaccccaggcct
tcatcagtgccaccatcaccttctgtctctcagcattccagccctcaccacagtgaaggc
gaagatgaagatgaggatgaaagatatgatgaagatgaagaggctgaaagggataggcaa
aacatcaaatctcccttttcccttggagtattacctcaagggaagacaaagcagcatgga
gagtacaggaactga

DBGET integrated database retrieval system