KEGG   Anas platyrhynchos (mallard): 101795250
Entry
101795250         CDS       T02816                                 

Gene name
CACNA1E
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent R-type calcium channel subunit alpha-1E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla04010  MAPK signaling pathway
apla04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:apla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101795250 (CACNA1E)
   04020 Calcium signaling pathway
    101795250 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:apla04040]
    101795250 (CACNA1E)
Ion channels [BR:apla04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101795250 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel Lustrin_cystein
Other DBs
NCBI-GeneID: 101795250
NCBI-ProteinID: XP_027318443
Ensembl: ENSAPLG00000011451
LinkDB
Position
8
AA seq 2382 aa
MQSTQSCNLLEPQSLAEALVSRAASFDALYQPRDADGDGGSALDLGQYVPISPDVIKRRR
GGLIEQRDIIKAHEAHKMQSTPQARRKEWEMARFGEAVAGRLGSGDGGSEQNRSRQGAPA
PAGGTPGAFKQTKAQRARTMALYNPIPVRQNCFTVNRSLFLFGEENIVRKYAKKLIDWPP
FEYMILATIIANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFVF
HKGSYLRNGWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIV
LKSIMKAMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACYTNNSGELEELDPPHPCGV
QGCPPGYECREWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLY
FIPLIIIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKA
EEVMLAEENKNSGTSALEVLRRATIKRNRTDTMNRDSSDEHCVDIASVGERRLAQRRPLH
PTLGNPLSRSGLKGARVDGASYLRHKERLLRISVRHMVKSQVFYWIVLSLVALNTACVAI
VHHNQPAWLTHFLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSFNCFDCGVTVGSIFEV
VWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIV
VFALLGMQLFGGRFNFIDGTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVRS
GMWSSIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEV
SPMSAPNMPAIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQRTSQLRRHMQMSSQE
GINKDEPPLINPHASIFRRKKPGDGVALEKCDEEQGGKGERPPAEGPEQPAPGSKAGGGE
DRRSPSPRARRDKELWHQKACHGNCEPGEEGAGGGIEERARMRQSQRRSRHRKARMEGKD
PALGSRSGSQEMGLEEAGPTEGAQDGDRRGDAAAALDLIQGEPEASGEPARTNGVLAEDG
SPPAAAPEPXRGLEGSLGEQDCSSPDTSEQALLGGAALGASRTVSRSEPDLSSATANTEK
ATESTAIMIDVQESAVVQISNKTDGEASPLKEAESKEDEEEMEKKKRKKEKSETGKAMVP
HSSMFIFSTTNPVRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSDRNKVLRYF
DYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFIVVVGALVAFALANALGTNKGR
DIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQ
LFKGKFFYCTDSSKDTEKDCIGNYVDHEKNKMEVKCREWKRHEFHYDNIIWALLTLFTVS
TGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQ
GDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIA
LNTVVLMMKYYSAPYTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFIT
VIGSITEIILTDTKLVNTSSFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPY
VCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFLGSLMLLFRSATGEAWQEIM
LSCLEGKGCEPDTTATSGQNENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYL
TRDSSILGPHHLDEFVRIWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKR
LVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADWQQLDSELQKEILTIWPHLSQK
MLDLLVPMPKTSDLTVGKIYAAMMIMDYYKQSKAKKQRQQLEEQKNAPMFQRMEPSSLPQ
EIISNAKALPYLQQDTLSGLSSRSGFPSLSPLSPQEIFQLACMDPAHGQFQEHQSLEPEV
REFQRVQPSNRGSYLPVDTQDHAVSGRASSMPRLTVDPQVVTDTSSMRRSFSTIRDKRTN
TSWLDEFSMERSSDNTYKSRRRSYHSSLQLSARRLNADSGHRSDGHRSGGRERGRSKERK
HLLSPDISRCNSEERSPQAHDESPERRRESRSPSEGRSQTPNRQGTGSLSESSIPSISDT
STPRRGRRQLPPVPPKPRPLLSYASMLRHAAGDASPPPEETEGGSPLLSKEPNAAGLTES
SSSPAGKPSRPSTPQRYISEPYLALHDDSHASDCGEEETLTFEAAVATSLGRSNTIGSAP
PLRHSWQMPNGHYRRRRRGAGQGVMCGASIDVLSDTEEDDKC
NT seq 7149 nt   +upstreamnt  +downstreamnt
atgcagagcacccagtcctgcaacctgctggagccccagagcctggccgaggcgctggtg
tcgcgcgccgccagcttcgacgccctctaccagccccgcgatgccgacggcgacggtggc
agcgccctggacctggggcagtacgtccccatcagcccggacgtcatcaagcgccgtcgg
ggcgggctgatcgagcagagggacatcatcaaggcgcacgaggcgcacaagatgcagagc
acgccgcaggcacggaggaaggagtgggagatggctcgcttcggggaggcggtggccggc
aggcttggctctggagatgggggctcggagcagaaccggagccggcaaggagctcctgcc
cctgcgggagggaccccgggagccttcaagcaaaccaaagcgcagcgagcccggactatg
gctctgtacaaccccatccccgtccggcagaactgcttcaccgtcaacagatccttgttc
ctctttggggaagagaacatagtcaggaaatacgccaagaagctcatcgactggccgccc
tttgagtacatgatcctggccaccatcatcgccaactgcatcgtgctggccctggagcag
cacctccccgaggacgacaagacgcccatgtcacggagactggagaagacggagccgtac
ttcatcgggattttctgcttcgaggctgggattaagatcgtggctctgggcttcgtgttc
cacaagggctcctacctgcgcaacggctggaacgtgatggacttcatcgtggtcctcagc
ggcatcctcgccacggccgggacgcacttcaacacgcacgtggacctgcgcaccctgcgc
gccgtgcgcgtcctcaggcccctgaagctcgtctcgggcattcccagcctgcagatcgtg
ctgaagtccatcatgaaggccatggtgcctctcctccagatcggcttgctgctctttttc
gccattctcatgtttgccatcatcggcctggagttctacagcgggaagctgcaccgagcc
tgctacaccaacaattcaggcgagctggaggagctggaccccccccacccgtgcggggtg
cagggttgccctccgggctacgagtgccgggagtggatcggtcccaacgacgggatcacg
cagttcgacaacatcctcttcgctgtgctgaccgtcttccagtgcatcaccatggaaggg
tggaccacagtcctgtacaacaccaatgatgccttaggagccacctggaactggctgtac
ttcatccccctcatcatcattggatccttcttcgtcctcaaccttgtcctgggagtgctg
tcgggggagtttgccaaagagcgcgagcgcgtggagaaccgccgagccttcatgaagctg
cggcgccagcagcagatcgagcgggagctcaacggctacagggcctggatagacaaagcg
gaggaagtcatgctggccgaagagaacaaaaattctgggacctcagccttagaagtgctc
aggcgagccaccatcaaaaggaaccggacggacaccatgaaccgcgactccagcgacgag
cactgcgtcgacatcgcctcggtgggcgagcggaggctggcgcagagaagacctctccat
cccaccctggggaaccccttgagccgctcgggcctgaaaggcgccagggtggacggtgcc
tcctacctgcggcacaaggagcgcctcctgcgcatctccgtccgccacatggtgaaatcc
caggtcttctactggatcgtcctgagcctggtagccctcaacaccgcctgcgtggccatc
gtgcatcacaaccagcccgcctggctcacacacttcctctactatgcagagttcctgttc
cttgggctcttcctcctggagatgtccttgaagatgtatggcatggggccacgcctgtac
ttccattcttccttcaactgctttgactgcggggtcacggtgggcagcatctttgaagtg
gtttgggccatcttcagaccgggaacctcctttgggatcagtgtcttacgagcccttcgt
ctcttacgaatatttaaaataaccaagtactgggcatccttgaggaatttggtggtctcg
ctgatgagctccatgaagtctattatcagcttgctcttcctccttttcctcttcatcgtg
gtctttgccctgctgggcatgcagctgtttggaggcaggtttaacttcatcgacgggaca
ccatcagccaacttcgacactttccccgcagccatcatgacggtgttccagatcctgacg
ggcgaggactggaacgaggtgatgtacaacggcatccgctcgcagggaggcgttcgctcg
ggcatgtggtcctccatctacttcatcgtcctcaccctgttcggaaactatactttgctg
aacgtcttcttggccatcgcggtggacaacctggccaacgctcaggagctcaccaaggat
gagcaggaggaagaggaggcctttaaccagaagcacgcccttcagaaagccaaggaagtc
agccccatgtccgcccccaacatgccagctatcgaaagagacaggcgcaggagacaccac
atgtcgatgtgggagccgcgcagcagccacctgcgggagcggcgccggcggcaccacatg
tcggtgtgggagcagcgcaccagccagctgcgccggcacatgcagatgtccagccaggag
ggcatcaacaaggacgagccccctctcatcaacccccacgccagcatcttccgacgcaag
aaaccgggcgacggcgtcgccttggagaagtgcgacgaggagcagggcggcaagggcgag
cggccgccagccgagggtcccgagcagccggccccggggagcaaggcgggcggtggggag
gacaggaggagcccatcgccccgggccaggcgggacaaggagctgtggcaccaaaaagcg
tgccacgggaactgcgagccaggcgaggaaggggcaggaggtggcatcgaggagagggca
cggatgaggcagagccagcggcgcagccggcaccgaaaagccaggatggaggggaaggat
ccggccctggggagccgctcgggcagccaggagatggggctggaggaggccggccccacg
gagggggcgcaggacggggaccggcgcggggatgctgccgcggcgctggacctgatccag
ggcgagccagaggcgagcggggagcccgccaggactaacggggtccttgctgaggatggg
agccccccggcagcggcacccgagcccncccgggggctggagggcagcctgggcgagcag
gactgcagcagcccggacaccagcgagcaagccctgctggggggagcggcgctgggggcc
agccgcaccgtcagccgcagcgagcccgacctctcctccgccaccgccaacaccgagaag
gccaccgagagcactgccatcatgatcgatgtccaagagtccgctgtggtacagattagc
aacaagaccgacggggaagccagccccctgaaggaggcagagagcaaggaggatgaggag
gagatggagaagaagaagcggaagaaggagaagagcgagacgggcaaagcgatggtgccg
cacagctccatgttcatcttcagcaccacgaacccggtgcgcagagcctgccactacatc
gtgaacctgcgctacttcgagatgtgcatcctcctggtcatcgccgccagcagcatcgcc
ctcgcggccgaggatcccgtcctcaccaactccgaccgtaacaaggtcctgaggtatttt
gactacgttttcaccggggtgttcaccttcgagatggttatcaagatgatcgaccagggc
ttgatcctgcaggacggctcctacttccgagacctctggaacatcctggacttcatcgtg
gtggtgggagcgctggtggctttcgccttggcgaatgctttggggaccaacaagggccgg
gatatcaagaccatcaagtccctccgtgtgctgcgggtcctgaggcccctgaaaaccatc
aagcggctgcccaagctgaaggccgtcttcgactgcgtcgtgacctccctcaagaacgtc
ttcaacatcctcatcgtctacaagctcttcatgttcatcttcgccgtcattgccgtccag
ctcttcaaggggaagttcttctactgcactgacagctccaaggacacggagaaggactgc
atagggaactacgtggaccacgagaagaacaagatggaggtgaagtgccgggagtggaaa
cgacacgagtttcactacgacaacataatctgggcactgctcaccctgttcacagtctcc
acgggcgagggttggccccaggtgctgcagcattcggtggacgtgacggaggaggaccgc
gggcccagccgcagcaaccgcatggagatgtccattttttatgtcgtctactttgtggtc
tttcccttcttctttgtcaacattttcgtggctctcatcatcatcaccttccaagagcaa
ggagacaaaatgatggaggagtgcagtctggagaagaacgagagagcctgtattgacttt
gccatcagtgccaagcccctgacgcgctacatgccccagaaccggcacaccttccagtac
cgggtctggcacttcgtggtctccccgtcctttgagtacaccatcatggccatgatcgcc
ttgaacaccgtggtgctgatgatgaagtactactctgctccgtacacctacgagctggcc
ctgaagtacctgaacattgcattcaccatggtcttctccttggagtgcgtcctcaagatc
attgcttttggcttcctgaattatttccgggacacctggaacatcttcgacttcatcact
gtcatcggcagcatcacggagatcatcctgacggacaccaagctggtgaacaccagcagc
ttcaacatgagcttcctgaagctcttccgagcggctcggctcatcaagctgctgcgccag
ggctacaccatccgcatcctgctctggacgttcgtgcagtccttcaaggccctcccctac
gtctgcctcctgatcgcgatgcttttcttcatctacgccatcatcgggatgcaggttttt
ggcaacatcaagctggatgaggaaagccacattaaccggcacaacaacttccgcagcttc
cttggctccctcatgctcctcttcaggagtgccaccggggaggcatggcaggagattatg
ctgtcctgcctggagggcaagggctgcgagccggacacgacggcgacatctgggcagaac
gagaacgagcgctgtggcaccgacctggcctacgtctacttcgtctccttcatcttcttc
tgctcgtttctgatgctcaacctgttcgtggccgtcatcatggacaactttgaatacctg
acccgcgattcctccatcctggggcctcaccatctggatgagtttgtccggatctgggca
gagtatgacagagcagcgtgtggccgaatccattacactgagatgtatgaaatgctgact
cttatgtcaccaccgctaggcctcggcaagagatgtccttccaaagtggcctataagaga
ctggtgctgatgaacatgcccgtggccgaggacatgacggtccacttcacctccaccctg
atggcgctgatccgcaccgccctggacatcaaaatcgccaaaggtggtgcagactggcag
cagttagactccgagcttcaaaaggagatcctgaccatttggcctcacctgtctcagaag
atgctcgacctcttggtccccatgccaaaaacctctgacctgactgttggcaagatctac
gcagccatgatgatcatggactactacaagcagagcaaagccaagaagcagaggcagcag
ctggaggagcagaaaaacgcgcccatgttccagcgcatggagccctcctctttgccgcag
gaaatcatctcaaacgccaaggctctgccgtacctccagcaggacaccctctcgggcctg
agcagccggagcgggttcccctcgctgagcccgctctcaccgcaggagatcttccagctg
gcgtgcatggacccagcccacgggcagttccaggagcaccagtctctggagccagaggtt
agggagtttcaaagagtgcagccctctaaccgtggcagctaccttcccgtggacactcag
gaccacgctgtctctgggagggcctcctccatgcctcgtctcactgtggatccccaggtg
gtgacggacaccagctccatgcggcggtcgttttccaccatccgggacaagcgcaccaac
acctcctggctggacgagttctccatggagcgcagcagcgacaacacctacaagtcccgc
cggcgcagctaccactcctcgctccagctctccgcccggcgcctcaacgccgactcgggc
cacaggtccgacgggcaccgctcgggcggcagggagcggggccgatccaaagagcgcaag
cacttgctgtcccccgacatctcccgctgcaattcggaggagaggagtccccaggcgcac
gacgagtccccggagcggcggcgcgagtcccggtcacccagcgagggcaggtcgcagaca
cccaacaggcagggaacgggctcgctgagcgaaagctccatcccctccatctcggacacc
agcacgccccggcgaggccgccgccagctccccccggtgccccccaaaccacgtcccctc
ctctcctacgcctccatgctgcggcacgccgccggagacgcctcgccgccccccgaggag
accgaaggggggtccccgctcctctccaaggagcccaacgccgccggcttgaccgagtct
tccagctccccggcggggaagccgagccggccgtccaccccgcagcgctacatctcggag
ccctacctggccctgcacgacgactcgcacgcctcggactgcggcgaggaggagacgctc
accttcgaggcggccgtggccaccagcctgggccgctccaacaccatcggctcggccccg
ccgctgcggcacagctggcagatgcccaacgggcactaccggcggcggaggcgaggggcc
gggcagggcgtgatgtgcggggccagcatcgacgtgctcagcgacaccgaggaagacgac
aagtgctag

DBGET integrated database retrieval system