KEGG   Anas platyrhynchos (mallard): 101796000Help
Entry
101796000         CDS       T02816                                 

Gene name
SUV39H2
Definition
(RefSeq) suppressor of variegation 3-9 homolog 2
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101796000 (SUV39H2)
Enzymes [BR:apla01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101796000 (SUV39H2)
Chromosome and associated proteins [BR:apla03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101796000 (SUV39H2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101796000 (SUV39H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 101796000
NCBI-ProteinID: XP_005030425
Ensembl: ENSAPLG00000006124
LinkDB All DBs
Position
Un
AA seq 449 aa AA seqDB search
MEAGSERSCGSVTGCFHRRATLSLGLKALSAPGSALPQCLPSRALVVPSWYVPCLASLET
LQELCRKENLRCKSIGITNRSLKSYEVEYLCDYKVEEGTEYYLVKWKGWPESSNTWEPQK
NLKCPLLLQNFLSDKNEYLSRVKEGKALKVRNHVKALKPAVADYIVRKAKQRIALQRWKE
ELNRKKNHRGMILVENTVDLEGPPLDFYYINEYKPAPGINVINGITTGCECSDCPAEKCC
PKEAGFILAYNKKKKLKIQPGLPIYECNSFCRCGPDCPNRIVQKGTQYSLCIFRTNNGRG
WGVKTLQKIKTNSFVMEYVGEVITSEEAERRGQLYDNQGNTYLFDLDYDSDEFTVDAARY
GNVSHFVNHSCDPNLQVFNVFIDNLDLRLPRIALFSTRTIKAGEELTFDYQMKGSIDLTS
DSADGLSPSRKRIRTVCKCGAVCCRGYLN
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggaggctggctcggagcggagctgtggctcggttacgggatgctttcaccgtagggca
acgctctccctcggtcttaaggcgctttccgcccctggaagcgcgttgccgcagtgcctg
ccctccagagcgttggtggttccctcctggtatgtgccatgtctagcctcacttgagacc
ctccaagaattatgtaggaaggaaaatctcagatgtaaatccattggaatcaccaacagg
agtctaaagagttatgaggtggaatatttgtgtgactacaaggtagaagagggcacagag
tactatcttgtgaaatggaaaggatggccggagtcttcgaatacttgggaacctcagaaa
aatctgaagtgtccattgcttcttcaaaacttccttagtgacaagaatgaatacttgtct
cgagtgaaagaaggcaaagcgctgaaagtgagaaaccacgttaaagccttgaaacctgcg
gtcgcagattacattgtaaggaaggctaagcaaagaatagctctgcagagatggaaagaa
gagctcaacaggaaaaagaatcatagaggaatgattctggtagaaaacactgtggatctt
gaaggtcctcctttagacttttactacattaatgagtacaaacctgctccgggaataaat
gtaatcaatggaataacgactggctgtgaatgctcagactgccctgctgagaagtgctgt
ccaaaggaggctggctttattttggcttataataaaaaaaagaagctgaaaatccagcct
ggcttgcccatctatgaatgcaactcattttgtaggtgcgggcccgactgccctaatagg
atagtacagaagggcacgcagtattcgctttgcatcttccgaacgaacaacggacgaggc
tggggagtgaaaaccctccagaaaattaaaaccaacagttttgtgatggagtatgtcgga
gaggtgattacaagtgaggaagcagagagacggggccagctctatgacaaccagggcaat
acgtatttgtttgatttggactatgactcagacgaatttacagtggatgcagctcgctat
ggaaatgtgtcccactttgtgaatcacagctgtgatccaaatctccaagtcttcaacgtg
ttcattgacaacctcgacctgcgtcttcctcgaatagcactgttttccacgagaaccatc
aaggctggagaagagctcaccttcgactaccagatgaaaggttcaatagatctgacgtca
gactctgcagatggtctcagcccctccaggaagaggatcagaacagtctgtaaatgtgga
gctgtgtgttgcaggggttatctcaactga

DBGET integrated database retrieval system