KEGG   Anas platyrhynchos (mallard): 101796138
Entry
101796138         CDS       T02816                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla04012  ErbB signaling pathway
apla04068  FoxO signaling pathway
apla04110  Cell cycle
apla04115  p53 signaling pathway
apla04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:apla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101796138 (CDKN1A)
   04068 FoxO signaling pathway
    101796138 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101796138 (CDKN1A)
   04115 p53 signaling pathway
    101796138 (CDKN1A)
   04218 Cellular senescence
    101796138 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 101796138
NCBI-ProteinID: XP_021129539
LinkDB
Position
1
AA seq 152 aa
MERRPGKTTCARRNLFGPVDHKQLQQDFQHMLHNGAKGAQQKWNFDFLQDRPVEGLLQWE
GLEGRKVPAFYSCVVGEARRPLQHLYRPLDREDNSHHFAQIALTEKPKTSMKIGAKRIPE
GKKRRQTSLTDYYSAKKQIKMNTQAAAKKPTF
NT seq 459 nt   +upstreamnt  +downstreamnt
atggagcggaggccagggaagaccacatgtgctcggaggaacctctttggccctgtagac
cacaagcagctgcagcaggacttccagcacatgctgcacaacggtgcaaagggggctcag
cagaagtggaacttcgatttcctgcaggacaggccagtggaggggctactgcagtgggaa
gggctggagggccgcaaggtgcctgctttctacagctgtgtggtgggagaggctcggaga
ccactacagcacttgtaccggcccttggacagggaagacaacagtcaccactttgcacag
atagcactgacagagaagcccaaaacttccatgaaaataggagccaagaggatcccagaa
ggaaagaaaagaagacagacatctttaacagattactactcagcaaagaagcaaatcaag
atgaatacacaagctgctgcaaagaagccaactttctga

DBGET integrated database retrieval system