KEGG   Anas platyrhynchos (mallard): 101797285
Entry
101797285         CDS       T02816                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X2
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla04010  MAPK signaling pathway
apla04020  Calcium signaling pathway
apla04144  Endocytosis
apla04510  Focal adhesion
apla04540  Gap junction
apla04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:apla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101797285 (PDGFRA)
   04020 Calcium signaling pathway
    101797285 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101797285 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101797285 (PDGFRA)
   04540 Gap junction
    101797285 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101797285 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:apla01001]
    101797285 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:apla04090]
    101797285 (PDGFRA)
Enzymes [BR:apla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101797285 (PDGFRA)
Protein kinases [BR:apla01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   101797285 (PDGFRA)
CD molecules [BR:apla04090]
 Proteins
  101797285 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 101797285
NCBI-ProteinID: XP_005012768
Ensembl: ENSAPLG00000003497
LinkDB
Position
4
AA seq 1087 aa
MGTSPRTFLILGCFLTGPLLTFCQLPLPTIVPNRNEMVVQLNSNFTLKCSGDSEVSWQYP
VTEGSHRIDIRHEENNSGLFVTVLEVGNASAAHTGLYVCYYNHTQVEDGEVEGRNIYIYV
PDPDVPFVPSIPEDQFILVEEGDSTTIPCRTSDPNAQVTLINSLDKAVYAAYDNKRGFIG
NFPAGSYTCKTMVKGMEFKSDVFLIYILRATSQLPVEIEALKTVYKTGETIVVTCVVFDN
EVVNLQWNYPGKVKEKGVIKLDDIKVPSQKLVYTLTIPEASVKDTGDYECTARHATKEVK
ENKKVVITVHDKGFIHLEPQFSPLEAVNLHEVKNFVVDVQAYPAPKMYWLKDNVTLIENL
TEIVTSSSRVQETRFQSILKLIRAKEEDSGYYTLVAENEDEIKRYTFSLLIQVPALILDL
VDDHHGSAGGQTVRCLAEGTPLPDVEWLVCKDIKKCSNDTSWTLLTNNISDIHMEAHLDE
KNMVESQVTFQKVEETLAVRCVARNDLGAVTRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLSRHPEKPKKDLDIFGMNPADESTRSY
VILSFENTGEYMDMKQADTTQYVPMLERKEGSKYSDIQRSVYDRPASYKKKSLSESEVKN
LLSDDSSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATNEVYEIMVKCWNSEPEKRPSFYHLSEIVESLLPGEYKK
SYEKIHLDFLKSDHPAVTRMRGDCDNAYIGVTYKNEDKLKDRESGFDEQRLSADSGYIIP
LPDIDPVSEDELGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSSD
LVEDSFL
NT seq 3264 nt   +upstreamnt  +downstreamnt
atgggcacttccccaaggacattcttgatcctgggatgtttccttacaggcccgctccta
acattttgccagcttcctctgccgactattgttcccaacagaaatgaaatggttgtacag
ctcaattccaatttcacactcaaatgctctggagacagcgaagtgagctggcagtaccca
gtgaccgagggaagccacaggatagacatcagacatgaagagaacaacagtggcctcttc
gtgacagtgctggaagtaggaaatgcctcagccgctcacacgggcctgtatgtttgctat
tacaaccacacgcaagtggaggatggggaagtggaggggaggaacatctacatctatgtg
cctgacccagatgtgccttttgttccgtctataccagaagaccagttcatcctagtagaa
gaaggtgattccaccactatcccatgtcggacaagtgacccaaatgctcaagtgacttta
attaacagtttagacaaggctgtctatgctgcctatgacaacaaacgaggtttcatagga
aacttccctgcgggatcatacacatgcaaaacaatggttaaaggcatggagttcaagtct
gatgtgttcctcatctatattttaagagctacttcacagctgccagttgaaattgaagct
cttaaaactgtctacaaaacaggcgagaccatcgtagtaacttgtgtggtctttgacaac
gaggtggttaatttacagtggaattatcctgggaaagtgaaagaaaaaggtgtgataaaa
cttgatgatatcaaagtcccatcgcagaagctggtttacaccttgaccattcctgaggca
tcagtgaaagacacaggggattatgaatgtactgctcggcatgcaaccaaggaggttaag
gaaaataagaaagtagtcattacagttcatgacaaagggttcattcatctagagcctcag
ttcagccctttggaagctgtcaatctacatgaagtcaaaaattttgtcgtagatgtgcag
gcgtacccagctccaaaaatgtactggttgaaggataatgtgactctgattgaaaacctt
actgaaattgttactagttcaagcagagtccaggaaacaaggtttcaaagtatactaaaa
ttgatccgggccaaggaagaagatagtggatattatactctggttgctgaaaatgaagat
gagattaaaagatacaccttctctctgctaatacaagttccagccttgatcttagacctt
gtggatgaccaccacggctctgcagggggacagacagtgaggtgcttggcagaggggacc
ccacttcctgatgtggaatggctggtttgcaaggacattaaaaaatgcagcaatgacact
tcatggactcttctgactaacaatatctccgatatacacatggaagcccatctggatgag
aagaacatggtggaaagccaggtgaccttccagaaagtagaggaaaccctggctgtgcga
tgcgtggcaagaaatgacctcggtgctgttactcgggaactgaaacttgtggctcccacc
ttgcgatcagaactgacggtggctgctgcagtcctagtactgctagtgattgtgataatt
tcactgattgttctggtcatcatctggaaacagaagccaaggtatgagataagatggaga
gtcattgagtctatcagccccgacggccatgaatacatttatgtggaccccatgcaactg
ccttatgactccagatgggagtttcctcgagacgggttagtgcttggtcgaatccttggt
tctggtgcatttggaaaagtggttgaagggactgcatatggattgagtcgttctcaaccg
gtgatgaaagtagctgtgaaaatgctgaaacctacagctagatccagtgaaaaacaggcg
ctcatgtctgaactgaagataatgacacatctagggccccacctgaatattgtgaacctg
cttggagcttgtacaaaatcaggtcctatttacatcatcactgaatattgcttttatggt
gatttggtgaactatctgcacaagaacagggacaacttcctgagccgccacccagagaag
cccaagaaagatttggatatctttgggatgaacccagctgatgaaagcacaagaagttat
gtgattttatcatttgaaaacactggagaatacatggacatgaaacaagctgatactacc
cagtacgtgccaatgctggaaaggaaggagggatctaaatattctgatattcagagatct
gtgtatgatcgaccagcttcatataagaagaaatctttgtcagaatcagaagtcaaaaac
cttctttcagatgacagttcggagggcctcagcctactggatttgctgagcttcacctac
caggtcgcacggggaatggaattcttggcttctaaaaattgcgtacaccgtgacttggca
gctcgtaatgtccttctggctcaaggaaaaatcgtgaagatctgtgactttgggttggct
agagacatcatgcatgattccaactacgtctccaagggcagcacttttctcccagtaaaa
tggatggcacctgaaagcatttttgacaatctgtacacaacattaagtgatgtctggtct
tatggcattctgctgtgggaaatattttctcttggtggcacaccatatccgggcatgatg
gttgattctactttctacaataagataaagagtggctaccgaatggcaaaacctgatcat
gctaccaatgaagtgtatgagatcatggtgaaatgctggaacagtgaaccagagaaaaga
ccctctttttaccacttgagtgaaatcgtggagagcttgttgcctggagagtacaaaaag
agctatgagaagattcacctggacttcctgaaaagtgatcacccagctgtcacacgcatg
agaggggactgtgacaatgcttacatcggtgtcacctacaagaacgaagacaagttaaag
gacagggagagtggatttgatgagcagaggctgagtgctgacagtgggtacattatcccc
ctgcctgacattgaccctgtttctgaagatgagcttggcaagaggaaccggcacagttcc
cagacatctgaagaaagtgccattgaaactggttccagtagctctacttttatcaagaga
gaggatgaaaccattgaggacattgacatgatggatgacatcgggattgactcctcagac
ctggtagaggacagcttcctgtaa

DBGET integrated database retrieval system