KEGG   Anas platyrhynchos (mallard): 101797531Help
Entry
101797531         CDS       T02816                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla04110  Cell cycle
apla04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:apla00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    101797531 (HDAC1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101797531 (HDAC1)
Enzymes [BR:apla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101797531 (HDAC1)
Chromosome and associated proteins [BR:apla03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     101797531 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     101797531 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101797531 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    101797531 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 101797531
NCBI-ProteinID: XP_005020509
Ensembl: ENSAPLG00000014752
LinkDB All DBs
Position
Un
AA seq 451 aa AA seqDB search
MKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSK
QMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASG
FCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTG
DLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGD
RLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELP
YNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPEDAV
QEDSGDEEEEDPEKRISIRNSDKRISCDEEFSDSEDEGEGGRKNVANFKKAKRVKTEEEK
EEEEKKEEKEEEKAKEEKPEPKGVKEETKST
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaagccccacaggatccggatgacccacaacctgctgctgaactacggcctctacagg
aagatggagatctatcgccctcacaaggcaaacgcagaagaaatgaccaagtaccacagc
gacgactacatcaagttcctgaggtctatccgccccgataacatgtctgagtacagcaag
cagatgcagagattcaacgttggggaggactgccccgtgttcgatgggttgtttgagttt
tgtcagctctccgctggaggctctgttgccagtgctgtgaagctgaacaagcagcagaca
gacatcgctgtgaattgggcagggggccttcaccacgctaagaagtcggaggcttctggc
ttctgctacgtcaacgatattgtcctagccatcctggagctcctcaagtatcaccagaga
gtgctgtacattgacattgatattcaccatggggatggcgtggaggaagccttctatacc
acagaccgtgtgatgaccgtgtccttccataagtacggagaatacttcccaggaacaggg
gacctacgggacattggtgcaggcaaaggcaaatactatgctgtcaactaccccctccgt
gatggaatcgatgatgagtcctatgaggcgatattcaagccggtgatatctaaagtgatg
gagacgttccagcctagcgcagttgtcttgcagtgcgggtcggattctctgtcaggagac
aggctgggctgttttaatctcaccatcaaaggtcatgccaagtgtgtggagtttgtaaaa
agttttaatttgcctatgctgatgctgggaggaggtggctatacgatccgcaacgtggct
agatgctggacctacgaaactgctgtggctttggacactgaaatcccaaacgaacttcca
tataacgactattttgagtactttggacctgactttaagctgcacatcagtccctccaac
atgactaaccagaataccaacgagtatctcgagaagatcaagcaacgtctctttgagaat
ctgcgcatgctgcctcatgcccctggtgtccagatgcagccaattcccgaagatgctgtt
caggaagacagtggagatgaagaggaagaagatcctgagaaacgcatttcaatccgcaat
tctgataagagaatatcgtgtgatgaagaattctctgactctgaagatgaaggggaagga
gggcgcaaaaacgttgccaactttaagaaagcgaagcgtgtgaaaacagaagaggaaaag
gaggaagaggaaaagaaagaggaaaaagaagaggaaaaagcaaaagaggaaaaaccagaa
cccaaaggggtgaaggaagagacaaaatctacctaa

DBGET integrated database retrieval system