KEGG   Anas platyrhynchos (mallard): 101797881Help
Entry
101797881         CDS       T02816                                 

Gene name
LIG3
Definition
(RefSeq) DNA ligase 3
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:apla00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    101797881 (LIG3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:apla03400]
    101797881 (LIG3)
Enzymes [BR:apla01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     101797881 (LIG3)
DNA repair and recombination proteins [BR:apla03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     101797881 (LIG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N LIG3_BRCT DNA_ligase_A_C zf-PARP BRCT_2 RNA_ligase mRNA_cap_enzyme Synaptonemal_3
Motif
Other DBs
NCBI-GeneID: 101797881
NCBI-ProteinID: XP_012962844
Ensembl: ENSAPLG00000008964
LinkDB All DBs
Position
Un
AA seq 882 aa AA seqDB search
KEKKVKGTVRIGKIVPNPFTESGGEMKEWYHVRCMFEKLEKARATTKKIEDITDLEGWEE
LQDEEKELIQKHIAEATSKAASTPKKKATVQAKLTPTGQITSPSKDPLAAVNPKKFSGFT
AKPKNSEDVPANSSHKSSLSAKKSDPKHKDCLLREFRKLCAMVADKPSYNVKTQIIQDFL
QKGTGGDGFHGDVYLTIKLLLPGVIKIVYNLNDKQIVKLFSRIFNCSQEEMIRDLEQGDV
SETIRLFFEQSKSCPPAAKSLLTIQEVDEFLIQLSKLTKEDDQQSVLHDITRRCTGNDLK
CIIRLIKHDLKMNAGAKHVLDALDPNAYEAFKASRNLQDVVERVLKNQQEAEKMPGLKRT
LSVQASLMTPVQPMLAEACKSIEYAMKKCPNGMYAEIKYDGERVQVHKNGDHFSYFSRSL
KPVLPHKVAHFKDFIPQAFPGGHSMILDSEVLLIDNKTGKPLPFGTLGVHKKAAFQDANV
CLFVFDCIYFNDISLMDRPLRERRKFLHDNMVEIPNRILFSEMKHVTKASDLADMITRVI
REGLEGLVLKDIKGNYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYGQGSKGGMMSI
FLMGCYDPKSEKWCTVTKCAGGHDDATLARLQTELDMVKISKDPSKIPSWLKINKIYYPD
FIVPDPKKAPVWEITGAEFSKAEAHTADGISIRFPRCTRIRDDKDWKTATNLPQLKELYQ
LSKEKADFSVVAGEEEESTAGSSGENEGNSRSSTPHKTTKTPPSKSPAKAKKPEGTKAIT
ESPQKPEEKRGEKRKASEMDDNGKKTLLDIFTGVKLYLSPSVKDFNKIRRYFIAYDGDLV
PEFDTASATHVIGDIDENPGAKRVSPKWIWECIRKRRLVAPC
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
aaggagaagaaggtgaagggcacggtgcgcatcgggaagatcgtgcccaaccccttcacc
gagtccggcggggagatgaaggagtggtaccacgtcaggtgcatgttcgagaagctggag
aaggcccgcgccaccaccaagaagatcgaggacatcacggacctggagggctgggaggag
ctgcaggacgaggagaaggagctgatccagaagcacatcgcagaagctacgtccaaggct
gcaagtacgccgaagaaaaaagcaacagtccaagctaagctcactcccacaggacaaata
accagtccctcaaaggacccgttagctgctgtcaatccgaagaagttctctggcttcaca
gccaagccaaagaattcagaagatgtccccgcaaactcttcccacaagtctagcctgtct
gcaaaaaaaagtgatccgaagcacaaggactgcttgctgcgagagttcaggaagctctgc
gccatggttgctgacaagcctagctacaatgtgaaaacgcagatcattcaggacttcctg
cagaagggaactggaggagatggttttcatggtgacgtgtacctgaccattaagctgctg
ttaccaggcgtcattaaaattgtttacaacttgaacgataagcagatagtaaagctgttt
agtaggatttttaactgcagccaagaggaaatgatccgggacctggagcagggagatgtc
tccgagaccatacgcctcttctttgaacagagcaaatcttgtcctccagcagctaaaagt
ctcctgactatccaagaggtagatgagttcctaatccagctatcaaagcttactaaggaa
gatgaccagcaaagtgtgctgcacgatatcactcgcagatgtactggcaacgacctgaaa
tgcatcatcaggctaattaagcatgatctgaaaatgaatgctggtgcaaagcacgtgttg
gatgctttggatccaaatgcttacgaggcattcaaagcatcacgcaacctccaggatgtg
gtagagcgagtcctgaagaaccagcaggaggccgagaagatgccagggctgaagcgaacc
ctcagcgtgcaggcctccctgatgaccccagtgcagcccatgctggctgaagcctgcaag
tcaattgagtacgccatgaagaagtgcccaaatggcatgtatgcggagatcaaatacgat
ggtgagcgagtgcaggtccataaaaatggagatcacttcagctacttcagccggagcctc
aaacctgtccttcctcacaaagtagcacattttaaggacttcatcccccaggctttccct
ggcgggcacagtatgatcctggattcggaagttcttctaattgataacaaaactggcaag
ccacttccttttgggactcttggtgtgcataagaaagctgctttccaagatgccaatgtt
tgcttgtttgtgtttgactgcatctatttcaatgacatcagcctgatggacaggcccctg
cgcgagcgtcgcaagtttctacatgataacatggttgaaatccccaaccggatcctcttc
tcagagatgaagcatgtcacaaaagcttcggatctggcagatatgatcacccgagtcatc
cgtgaaggactggaaggactggtgttgaaagatataaagggtaattatgaaccaggaaaa
cggcactggctgaaagtgaaaaaggactacctaaacgagggtgcaatggctgacacagca
gacttggtggtgctgggagctttctatgggcaaggcagtaaaggtgggatgatgtccatt
ttcctcatgggctgctatgatcccaagagtgagaagtggtgtacagtgaccaagtgtgct
ggtggccatgacgatgccaccttggcccgtctccaaacagagctggatatggtgaagatc
agcaaggatcccagtaaaattccaagctggctaaaaattaacaaaatctactacccagac
ttcattgtcccagatccaaagaaagccccagtatgggagatcacaggagctgaattctct
aaagcagaagcccacactgcagatgggatctccattcgtttccctcgctgcacccgcatt
cgagatgataaggactggaagacagccaccaacctcccgcagcttaaggagctgtaccaa
ctctccaaagaaaaggctgacttcagtgttgttgctggggaggaagaagagtccacggct
ggcagcagtggagagaatgagggaaattccaggtcttccacaccacacaagactactaaa
actcccccaagcaagtcacctgcaaaagccaagaagccagaaggcactaaagcaatcact
gaatcccctcaaaagccagaggagaaacgaggagagaagcgaaaagcatctgagatggat
gacaacggaaagaagacactgctggacatattcactggtgtgaagctgtacctatcgccc
tcggtgaaggatttcaacaaaatccgtcgctacttcatagcctacgatggtgatcttgtg
ccagagtttgacacagcctcagcaacacatgttataggggacattgatgagaatcctggt
gctaaacgtgtatctcccaaatggatctgggaatgcatccgcaaacggagactggtagcc
ccatgctag

DBGET integrated database retrieval system