KEGG   Anas platyrhynchos (mallard): 101797981Help
Entry
101797981         CDS       T02816                                 

Gene name
ACAA1
Definition
(RefSeq) 3-ketoacyl-CoA thiolase, peroxisomal
  KO
K07513  acetyl-CoA acyltransferase 1 [EC:2.3.1.16]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00071  Fatty acid degradation
apla00280  Valine, leucine and isoleucine degradation
apla00592  alpha-Linolenic acid metabolism
apla01040  Biosynthesis of unsaturated fatty acids
apla01100  Metabolic pathways
apla01212  Fatty acid metabolism
apla03320  PPAR signaling pathway
apla04146  Peroxisome
Module
apla_M00087  beta-Oxidation
apla_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101797981 (ACAA1)
   00592 alpha-Linolenic acid metabolism
    101797981 (ACAA1)
   01040 Biosynthesis of unsaturated fatty acids
    101797981 (ACAA1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101797981 (ACAA1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101797981 (ACAA1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101797981 (ACAA1)
Enzymes [BR:apla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     101797981 (ACAA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt ACP_syn_III_C Dodecin
Motif
Other DBs
NCBI-GeneID: 101797981
NCBI-ProteinID: XP_027306159
Ensembl: ENSAPLG00000006202
LinkDB All DBs
Position
2
AA seq 440 aa AA seqDB search
MAAAAGGEAKMAAGSGSGALRRVRAVLGHLAGQPPAAVRAAPCGSWPGGASCPEDVVVVH
GRRTAIGRAKRGGFKDTTPDELLSAVMTAVLQDVGLRPEVLGDICVGNVLQPGAGALVAR
VAQFLSGIPETVPCSSVNRQCSSGLQAIINIAGGIRNGSYDIGLACGVETMSLRSANNPG
DISSSMMENSKARDCLIPMGITSENVAEKFGVSRKKQDAFALASQQKAAKAQQLGLFKAE
IVPVKTTVQDKEGNQQTITVHQDEGIRPSTTLEGLAKLKPAFKENGSTTAGNASQVSDGA
AAVLLAKRSKAAQLGLPVLGVLKSFAVVGVPPDVMGIGPAYAIPAAVEKAGLTLNDIDIF
EINEAFASQAVYCVEKLGIPMEKVNPLGGAIALGHPLGCTGARQVVTLLNELXXXXAYGV
VSMCIGTGMGAAAVFEYPGN
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcgggcggggaagccaagatggcggcgggcagcggcagcggggcgctg
aggcgggtgcgggcggtgctggggcacctggcggggcagcccccggccgccgtgagggca
gcaccgtgcgggagctggcccgggggagcttcgtgtcccgaggatgtggtggtggtgcac
ggcaggaggacggccatcggccgagccaagcgcggggggttcaaggacaccacgcccgat
gagctgctctctgccgttatgaccgctgtcctgcaggacgttgggcttcggccagaggtg
ttgggggacatctgtgtggggaacgtgctgcagccgggagctggcgctttggtcgcgaga
gttgcacaatttctaagtgggatcccagagacggtgccgtgctcgagtgtcaaccggcag
tgctcctccgggctgcaggccattatcaatatagctggtggcatccgaaatgggtcgtat
gacattggcctggcctgtggcgtggaaacgatgtccctcagaagcgccaataaccctggc
gatatcagctccagtatgatggagaacagcaaagctcgagattgccttattcccatggga
ataacctcagagaatgtggcggagaagtttggagtttcccgcaagaagcaagacgccttt
gccttggcttcccaacaaaaagcagcgaaagctcagcagctgggactgtttaaagccgag
attgtcccagtcaagaccactgtccaagataaggagggcaaccaacaaacaatcaccgtg
caccaagacgaagggattaggccctccaccaccctggaaggcttggcaaagctgaagcct
gccttcaaggagaacggcagcaccacagcaggcaacgccagccaggtcagtgatggagca
gctgcagttctgctggcaaaacgctccaaagcagcacagctggggctgccggtgctgggg
gtgctcaagtccttcgccgtggtcggagtcccgcccgatgttatgggcattgggccagcc
tacgccatccctgctgctgtggagaaggcaggtctgacactaaatgacattgatatattt
gaaatcaacgaagcctttgcaagccaggctgtgtactgtgttgaaaagctgggcattccc
atggagaaggtcaaccccctgggaggagcaatagccctggggcaccccctgggctgtacg
ggtgcccggcaagttgtcaccttgctcaatgaattgnnnnnnnnnngagcgtatggtgtt
gtgtcaatgtgcattggaactggtatgggagctgcagcagtatttgaatacccagggaac
taa

DBGET integrated database retrieval system