KEGG   Anas platyrhynchos (mallard): 101798388Help
Entry
101798388         CDS       T02816                                 

Gene name
MGST2
Definition
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00480  Glutathione metabolism
apla00980  Metabolism of xenobiotics by cytochrome P450
apla00982  Drug metabolism - cytochrome P450
apla00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    101798388 (MGST2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101798388 (MGST2)
   00982 Drug metabolism - cytochrome P450
    101798388 (MGST2)
   00983 Drug metabolism - other enzymes
    101798388 (MGST2)
Enzymes [BR:apla01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101798388 (MGST2)
Transporters [BR:apla02000]
 Other Transporters
  Pores ion channels [TC:1]
   101798388 (MGST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG DUF5472
Motif
Other DBs
NCBI-GeneID: 101798388
NCBI-ProteinID: XP_005022467
LinkDB All DBs
Position
Un
AA seq 146 aa AA seqDB search
MGDFTLLAAVSLLSAFQQSHFAWLVGRSRMKHKIMPPAVTGAPEFDRTFRAQQNCAEFYP
IFMTLLWITGWFFNQEVAAVLGLLYMFARYKYFHGYAQSVKGRLTGFYLSLIVLTCLVTL
GAAGIVNSFLDEYLNFRIMKKLRKMF
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgggggacttcaccttgctggccgctgtctccctcctctctgccttccagcaaagtcat
tttgcttggctggtggggagatcgaggatgaagcacaagatcatgcccccagctgtcact
ggagctccggagtttgacagaacatttcgtgcgcaacaaaactgtgcggagttttatcca
atattcatgactctcctctggatcacagggtggttttttaaccaagaagtagccgcagtt
ctgggcctgttgtacatgttcgcccgctacaagtacttccacggttacgcgcagtcagtg
aagggaaggttaacaggtttttatttgagtttgatagttctgacttgcttggtaaccctg
ggtgcagctgggattgtcaacagctttctggatgaatacctgaacttcagaatcatgaag
aaattaagaaaaatgttctga

DBGET integrated database retrieval system