KEGG   Anas platyrhynchos (mallard): 101798526Help
Entry
101798526         CDS       T02816                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin G/H synthase 1 isoform X1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00590  Arachidonic acid metabolism
apla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    101798526 (PTGS1)
Enzymes [BR:apla01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     101798526 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 101798526
NCBI-ProteinID: XP_027326713
LinkDB All DBs
Position
18
AA seq 610 aa AA seqDB search
MGGGCRPRAPPAGLRLLLGPALLLCAAGSAAAAGTGTVNPCCYYPCQHQGVCVRVGLEGY
ECDCTRTGYFGTNCTSPELWTRLHNLLKPSPAFYHFVLTHFRWFWDIINSTFIRDTLMRL
VLTVRANLIPSPPTFNSNYGYISWEAYANVSYYTRILPPVPDDCPTPMGTKGKRQLPDAQ
LLAERFLLRHKFEADPRGTNLMFAFFAQHFTHQFFKTSGKMGRGFTKALGHGVDLGHLYG
DNLQRQHQLRLFRDGKLKFQVVDGEVYPPSVTEAPVHMVYPPAVPKEKQLAMGQEVFGLL
PGLCMYATLWLREHNRVCDILKQEHPTWSDEQLFQTARLILIGETIKIVIEDYVQHLSGY
FLSLKFDPELLFGRQFQYRNRIAVEFNQLYHWHGLMPDSFVIQGEEYSYEQFLYNTSMLL
DYGVEALVESFSKQTAGMIGGGQTINANVLKVAVGVIMESRQLRLQPFNEYRKRFGMKPY
KSFQELTGEEEKAAELEELYGDIDALEFYLGLLLEKPQPNGIFGESMVEIGAPFSLKGLL
GNPICSPEYWKPSTFGGATGFEIVKTASLEKLVCLNVKRCPYVAFRVPDAAAGGTAGSSR
GGGGGPSTEL
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgggcggtgggtgccggccccgggcccccccggccgggctgcggcttctgctcggcccc
gcgctgctgctctgcgccgccgggagcgccgcggccgccggcaccggcaccgtgaacccg
tgttgctattacccctgccagcaccaaggggtgtgcgtgcgggtcggcctggaaggctac
gagtgcgactgcacgcggacggggtacttcgggactaactgcacctcgcccgagctctgg
acgcgcctccacaacctgctgaagcccagtcccgccttctaccacttcgtcctgactcac
ttcaggtggttttgggacatcatcaacagcaccttcatcagggacacgctgatgaggctc
gtgctcacagttcgtgccaacctcatccccagcccccccacctttaactccaactacggc
tacatcagctgggaggcctacgccaacgtcagctactacacccgcatcctcccgccggtg
ccagacgactgccccacgcccatggggaccaaagggaagcggcagctccccgacgcccag
ctcctggcggagaggttcctgctgcggcacaagttcgaagccgatccccggggcaccaac
ctgatgtttgccttcttcgcccagcatttcacccaccagttcttcaagacgtccgggaag
atggggcgaggcttcaccaaggcgctggggcacggggtggacctggggcacttgtacggg
gacaacctgcagcgccagcaccagctgcggctcttcagggacgggaagctcaaattccag
gtggtggatggagaggtgtaccccccctcggtcaccgaagcgccggtccacatggtgtac
ccgcctgccgtccccaaggagaagcagctggcgatgggtcaggaggtgttcgggctcctg
ccggggctctgcatgtacgccacgctctggctgcgtgagcacaaccgcgtctgcgacatc
ctgaagcaggagcaccccacctggagcgacgagcagctcttccagacagctcggctcatc
ctcatcggggagaccatcaagatcgtcattgaagactacgtgcagcacctcagcgggtac
ttcctcagcctcaagttcgaccccgagctgctgttcgggaggcagttccagtaccggaat
cgcatcgcggtggagttcaaccagctctatcactggcacgggctgatgccggactccttc
gtcatccagggggaagagtacagctacgagcagtttctctacaacacctccatgctcctg
gactatggcgtggaggccctggtggagtccttttccaagcagaccgcggggatgatcggc
ggggggcaaaccatcaacgccaacgtcctgaaagtggccgtcggggtcatcatggagtcg
cggcagctgaggctgcagcccttcaatgagtatcggaagaggtttggcatgaagccctac
aaatccttccaggagctcacaggagaggaggagaaggctgcagagctggaggagctctat
ggagacatcgatgcgctggagttttacctgggcttgctgcttgagaaaccccaacccaac
ggcattttcggagaaagcatggtggagatcggagctcccttttccctgaaggggcttctc
ggaaaccccatctgctccccggagtactggaagcccagtacctttggcggagcaactggc
tttgagatagtcaagacagcatccctggagaagctggtgtgcctcaacgtgaagaggtgc
ccgtacgtggccttccgtgtgccggacgccgcggcaggaggcacggccggcagcagccgg
ggcggtggtggtgggccctctacggagctctag

DBGET integrated database retrieval system