KEGG   Anas platyrhynchos (mallard): 101798588Help
Entry
101798588         CDS       T02816                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00052  Galactose metabolism
apla00500  Starch and sucrose metabolism
apla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101798588
   00500 Starch and sucrose metabolism
    101798588
Enzymes [BR:apla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     101798588
    3.2.1.20  alpha-glucosidase
     101798588
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 101798588
NCBI-ProteinID: XP_012964659
Ensembl: ENSAPLG00000002543
LinkDB All DBs
Position
Un
AA seq 1795 aa AA seqDB search
FLEILLITPYFISVTEFTPVCPNILIEERIDCIPDQLATKSICTLRGCCWNPQNDTSVPW
CFFPSNHGYKVDGSLRSTETGFEATLTRLPSPSLFGNDINTVLLTGEYQTSNRFRFKITD
PNTKRFEVPHEHVGPFNGPAASNLNYKVEVKNNPFGIVVTRVSNGKVLFDTSIGPLQYAD
QFLQLSIKLPSRNIYGVGEHVHKQYRHDVNWKTWPMFSRDIGPSGSMHNLYGVQTFFLCL
EDSSGASFGVFLMNSNAMDKYISISECTACLTHSSLVYIIQMVWGTEVTHTVSANGATNH
FTLNLQLVGLPLLPSYWSLGFQLSRWNYGSLDEVKKVVERNRLIDLPYDAQITDIDYMEN
RKDFTYDKVLFKDLPTFASYLHGFGKKYIIILDPAISTENLSDNSEYKSYTRGQSKRVWV
NESDGITTVFWGVWPGRTVFPDYTNPDCTSWWVEECRLFNETVPYDGIWIDMNEISNFVQ
GSNTGCAQNDLNYPPFTPSILDKLMFSKTLCMDAVQKWGKHYDVHSLYGYSMAISTNEAI
KTVFPGKRSFLISRSTFVGSGKHTGHWLGDNAATWEHIKWAIPGMLEFNLFGIPYIGADI
CGFFDDTTEELCRRWMQVGAFYPFSRNHNAEGYIPQDPAVFGADSVLVKTSKHYLNIRYT
LLPYLYTLFYKAHTQGDTVVRPVLHEFYSDEVTWEVDRQFLWGPGLLISAVLDPGVDVIQ
AYIPDAVWYEYETGAKISIRKQWTDLYLPADKMGLHLRGGYIYPTQQPAPTTSESRKNPM
GLIIALDDDNKAYGDLFWDDGESTGTLDNKNYIYYEFSVSDTTLQMNVINNGYVDPNNLK
FEEIKILGVLQEITGLTVTQNNVLQPSLHNITYYPSDKVVHITGLQLELGKSYTLKWTQQ
ASINERFDCYPNQNSTKEKCEQLGCVWEQSPSNPDSPSCYYNSDNAYSVDGVEYSSSGLV
ANLTLNSTNARANDKYTEPIGTLRLEVKYHSNHMLQFKIYDYQNARYEVPVPLNLPSSPV
NTNENLLYEVSVQRKPFGIQVRRKSTGTVIWDSQLPTFTFSDMFIQISTRLASQYIYGFG
ETEHTMFRRNMSWHTWGMFTRDQAPTYKLNSYGYQPFYMALEEDGNAHGVLLLNSNAMDV
TFQPTPALTYRTIGGILDFYMVLGPTPELVVQEYTELIGRPVMPPYWSLGFQLCRYGYRN
DSEISQLVEEMKAANIPYDVQYVDIDHMERQLDFTLGARFQGLPALINKIKAEGMRFIII
LDPTISGNETDYPTFSRGVEDDVFIKWPNTNDIIYSKVWPFLPNVTVNESLPEQTQIRLY
GAHAAFPDFLRNSTVEWWKREILEFYDNPRNNSQSVKFDGLWIDMNEPATFYNGALEGCR
DDLLNYPPYIPHLGYRSDGLIVKTPCMEGEQRLPDGTPVRHYDVHSLYGWSQTKPTLDAL
QNATKERGIVITRSTYPSSGKWAGHWLGDNKAAWDQLAKSIIGMMEFSLFGISYTGADIC
GFFNDSQYELCLRWMQLGAFYPYSRNHNEKGTRRQDPVSWDATFENISRKVLNIRYTLLP
YFYTLMYDAHAHGSTVIRPVLHEFVTDRTTWDIYEQFLWGPAILISPVMQPNAVTVDAYI
PDAIWYDYYTDTNIGVRGKSVTLPAPLDHINLHIRGGYIIAWQQPANTTFYSRKNPMGLT
VALNESQLAEGQLYWDDGVRIDAYEDGAYLLTSFTAKQNVLDITVVHHGYNDPNNLMFTE
IKVLGLSTTVGHVDVLQNGGTIPSSHKVNYDSTTQVLRITDLQLQLGQTYTVQWS
NT seq 5388 nt NT seq  +upstreamnt  +downstreamnt
tttttggaaatcctgttaataaccccttattttatttcagtaacagaatttacaccagta
tgtccgaacatattaatagaagagagaattgactgcatcccagatcaactagctacaaag
agcatctgcaccttgcgtggctgctgctggaatccccagaatgataccagtgtgccctgg
tgttttttccctagtaaccatgggtacaaagtggatgggtctctaagatcaactgagaca
ggatttgaggccacattaacaaggctgccgtcaccttccctctttggaaatgatatcaac
actgtcctcctcacaggagagtatcagacatcaaatcgcttccggttcaagattactgat
cctaatacaaaaagatttgaagtcccccatgagcatgtgggacctttcaatggacctgcc
gcctccaatttaaactacaaagtggaagtgaagaataatccatttggtattgtggtgacc
agagtgagcaacggaaaggttctgtttgatactagcataggaccactgcagtatgctgac
cagtttttgcagctatcaatcaagctacctagcagaaacatttatggggtgggagagcac
gtgcataaacagtaccgacatgatgtcaactggaaaacctggcccatgttcagcagggat
attggcccctctggatcaatgcataacttgtatggagttcaaactttcttcctgtgtttg
gaagacagctctggagcctcttttggtgttttcctgatgaacagcaatgccatggataaa
tatatatctatttcggagtgcactgcttgtcttacacactcaagcttagtgtatattatt
caaatggtttggggcactgaggtgacacacacggtgtctgctaatggggccactaatcat
tttactctcaacttgcagcttgtgggactgccattgttgccctcctactggagcctgggc
ttccagctcagtcgctggaattacgggtccttggatgaagtgaagaaagttgtggagagg
aatcgtctgattgacctcccttatgatgctcagattactgatattgactacatggagaac
aggaaagattttacatatgacaaagtgctgtttaaagatctccctacttttgcatcttat
ctgcatggctttggaaaaaaatatattatcatattggatcctgctattagcacagaaaat
ctatctgacaatagtgaatataaaagctacaccaggggacagtctaaacgagtctgggtt
aatgaatcagatggaataacaactgtattctggggtgtgtggccagggagaactgtgttt
ccagactacaccaacccagactgtaccagctggtgggtggaagaatgtaggttatttaat
gaaacagtgccatatgatgggatctggattgacatgaatgaaatatccaactttgttcaa
ggctcaaatacaggttgtgcacagaatgacttaaactatcctccatttactcccagtatt
cttgataaactcatgttttccaagacactttgtatggatgcagtacagaagtggggcaaa
cactatgatgtccacagtctttatggatattccatggccatatcaacaaacgaggccatc
aagacagtgtttcctggaaaacgaagcttcctgatttcgaggtctacttttgtgggatct
ggaaagcacacaggacactggctgggagataatgcagcaacatgggaacacataaaatgg
gcgatacctggaatgctggaatttaacctctttggaattccttatattggagcagatatt
tgtggtttctttgatgacacgactgaagaactttgcaggcggtggatgcaagtaggagcc
ttttacccattttcccggaatcacaatgctgaaggatacatacctcaggatccggctgtg
tttggagctgattcagttttggtgaaaacctccaaacattacttgaacattcgctacact
ttgctgccctacctctacaccctcttttacaaagctcatactcaaggggacacggttgta
cgtccagttttgcacgagttctactcggatgaagtgacgtgggaagttgataggcagttc
ctgtggggtcctggtctacttatttctgctgtccttgacccgggtgtggatgtaattcaa
gcatatattcctgatgcagtgtggtatgagtatgaaacgggggcaaaaatatcaataaga
aaacagtggactgatttgtacctgccagcagacaaaatggggctccatttgagaggaggc
tacatttaccctacccaacaaccagctcccacgacatctgagagtcgcaagaatccaatg
ggacttataattgccctggatgatgacaataaagcttacggggacttgttctgggatgat
ggagaatctacaggcacacttgacaataaaaactacatttactatgagtttagcgtttct
gatactactctacaaatgaatgtcataaacaatggttatgttgatccaaacaacctgaag
tttgaagaaatcaaaattctgggagtgctccaggaaataacaggacttacggtcactcag
aacaatgttctgcaaccttctttacataatatcacctactatccttcagataaggttgtt
catataacaggacttcagcttgaactgggaaaatcctacacactgaaatggactcaacaa
gcaagtatcaatgaaaggtttgattgttatcccaatcagaattcaacaaaagaaaagtgt
gaacaacttggctgtgtctgggagcaatcaccatcaaacccagatagtccatcctgctat
tacaactctgacaacgcttactctgttgatggagtagaatactcctcatcaggtttggta
gctaacctgaccttaaacagcaccaatgccagagctaatgacaagtacactgaaccaatt
ggtacgctgcgcttggaggttaaatatcatagcaaccacatgctgcaatttaagatttat
gattaccagaatgcacgatatgaggttcctgtaccattaaatctcccaagctccccagtg
aatacaaacgagaatctactctatgaagtatcagttcagagaaaaccatttggtatacag
gttcggcgcaaaagcacagggacagtcatctgggattcacagctgcctaccttcacattc
agcgacatgttcattcagatttctacccgcttggcatcccaatatatatatggatttgga
gaaaccgagcacaccatgtttcgacgcaacatgagctggcacacctggggaatgttcaca
agggaccaggctcctacttataagttgaattcctatggttatcagccattttacatggct
cttgaagaagacggcaatgcccatggagttctcttgcttaacagcaatgcaatggatgtg
acattccagccaacccctgccctgacataccgcaccattggaggaatccttgacttttac
atggttttgggcccaacaccagaacttgttgttcaggagtacactgaactgattggacga
ccagtgatgccaccctactggtccttgggattccagttgtgccgctatggatacaggaat
gacagtgaaatttcccagctggtggaggaaatgaaggcagctaacattccctatgatgtc
caatatgtagatattgaccatatggaacggcaactggatttcactcttggcgcacgcttt
cagggattaccagctctaattaacaaaataaaagcagaaggaatgagattcatcattatc
ctggatccaactatctctggaaatgaaactgattatcctacgttctcgagaggtgtggaa
gacgatgtcttcatcaagtggccaaataccaatgacattatatattccaaggtctggccg
tttcttcccaacgttacagtcaatgagtcacttcctgagcaaactcaaatacggctctat
ggagcacatgcagctttcccagacttcttacgcaattccacagtggagtggtggaagaga
gaaatcctggagttctacgacaatccccgtaacaactcacaaagtgttaagtttgatggc
ctgtggattgacatgaatgaaccggcaactttttataatggcgcccttgaaggctgtaga
gatgacctccttaattacccaccatacattcctcatttgggataccggtcagatggttta
attgtcaaaactccgtgcatggaaggtgagcagcgtcttccggatggtaccccggttaga
cactatgatgtccacagtctttacggatggtcacaaacaaaacctaccctcgacgctttg
cagaatgccacaaaggagcgcgggattgtcatcacccgctcaacatatcccagcagtgga
aaatgggctggacattggctgggcgataacaaggcagcttgggatcagctggctaaatcg
attattggtatgatggagttcagtctctttggaatatcttatacaggagctgatatctgt
ggcttctttaatgactcacagtatgagttgtgtcttcgctggatgcagctgggtgcattt
tacccatattcgaggaatcacaatgagaaaggaacaagaaggcaagatcctgtttcctgg
gatgcaacatttgagaacatttccaggaaagtgctgaatataagatacactctcttaccc
tatttttatacattaatgtatgacgcccatgcccatggcagcactgtgatccgtcccgta
ctccatgagtttgtgacagacagaacaacatgggatatatacgaacaattcctttgggga
cctgcaattctcatcagccctgtaatgcaaccgaatgctgtaacagtggatgcttacata
cctgatgccatctggtatgattactacacagatacaaatattggtgttaggggaaaatca
gtaactctaccggcacctttggaccatatcaatcttcatattcgaggcggttacatcatc
gcgtggcaacaacctgctaatacaactttttacagccggaaaaacccaatgggacttact
gttgctttgaatgagtctcagttggcagaaggacagctttattgggatgatggtgttcgc
atagatgcatatgaagacggtgcatatctgctaacatcatttactgctaagcagaatgtt
ttagatatcacagttgtgcatcatggttacaatgatccaaacaacttaatgtttactgaa
attaaagtgcttggcttgagcacaactgttgggcacgtggatgtattgcagaacggtggg
acaattccgtcaagtcacaaggtgaactacgacagcaccacccaggtcctgagaatcaca
gatcttcaacttcaattaggccaaacctacacagtgcaatggagttaa

DBGET integrated database retrieval system