KEGG   Anas platyrhynchos (mallard): 101800431Help
Entry
101800431         CDS       T02816                                 

Gene name
SORD
Definition
(RefSeq) sorbitol dehydrogenase isoform X1
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00040  Pentose and glucuronate interconversions
apla00051  Fructose and mannose metabolism
apla01100  Metabolic pathways
Module
apla_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101800431 (SORD)
   00051 Fructose and mannose metabolism
    101800431 (SORD)
Enzymes [BR:apla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     101800431 (SORD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 DUF2249 DUF281
Motif
Other DBs
NCBI-GeneID: 101800431
NCBI-ProteinID: XP_027321926
Ensembl: ENSAPLG00000004875
LinkDB All DBs
Position
11
AA seq 355 aa AA seqDB search
MAAPGQNLAVVVHRAGDLRLENRPIPEPGPNEVLLRMHSVGICGSDVHYWQHGRIGDFVV
KDPMVLGHEASGTVVKVGSGVTHLKPGDRVAIEPGVPRETDEFCKTGRYNLSPTIFFCAT
PPDDGNLCRYYKHSASYCYKLPDNVTFEEGALIEPLSVGIHACKRAGVTLGSKVFVCGAG
PIGLVNVIVAKMMGAATVVVTDLSASRLQKAKEVGADFIIQVKNESPQEVASKVESLLGC
MPEITVECTGVQACIQAGIYATRSGGTLVLVGLGPEMVTVPIVNAAVREVDIRGIFRYCN
TWPVAIALLASKRINVKPLVTHRFPLEKALEAFEATKRGEGVKVMLKCDPTDHNP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgccggggcagaacctggccgtggtggtgcaccgagccggggacctgcgcctg
gaaaaccgtccgatcccagaaccgggtcccaatgaggtcctcctgcggatgcattctgtt
gggatctgcggatctgatgtgcactactggcagcatggtcgaattggagattttgttgta
aaggatcctatggtgttggggcatgaagcttccgggactgtcgtcaaagtgggatcagga
gtaactcatctgaaaccaggtgatcgagtggctatcgagcccggcgtcccaagagaaacg
gatgagttctgcaaaactggccgctataacctgtccccaaccatctttttctgcgcgacg
cctcccgacgatgggaacttgtgccgctactacaagcacagtgccagctactgctacaag
cttccagataatgtcacctttgaagaaggggcccttattgagcccctttcggtgggaatc
catgcttgcaaaagagcgggagtcactctgggaagcaaagtcttcgtgtgtggcgctgga
ccaattggccttgttaatgtgattgttgccaagatgatgggtgcagcaactgtggtagtt
acagatttatctgcctcccgcctgcaaaaagccaaggaggtgggggcagatttcatcatt
caggtaaagaacgagtcccctcaggaggtggcctccaaagtggaaagtctgcttggctgc
atgcctgagataactgtggagtgcacaggagtgcaagcctgcatccaggccggcatttac
gccactcgttctggtgggacactggttctggttgggctggggcctgagatggtgaccgtg
cccatcgtgaacgctgctgtgcgggaggtggatatccgggggatattccgctactgcaac
acgtggcccgtggcaattgccttgctggcatccaagcggatcaatgtcaagcccttggtc
acacaccgcttccccctggaaaaggctcttgaggcgtttgaggccacgaagaggggcgag
ggggtaaaagttatgctgaagtgcgaccccactgaccacaacccctga

DBGET integrated database retrieval system