KEGG   Anas platyrhynchos (mallard): 101800582Help
Entry
101800582         CDS       T02816                                 

Gene name
TGM2
Definition
(RefSeq) transglutaminase 2
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
apla  Anas platyrhynchos (mallard)
Brite
Enzymes [BR:apla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101800582 (TGM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 101800582
NCBI-ProteinID: XP_012959067
LinkDB All DBs
Position
Un
AA seq 611 aa AA seqDB search
MRGARPRPGAGISLPAREGAAGGRASPTAASAELVLETWDLQCESNGREHRTAEMGGQQL
VVRRGQPFTITLHFSGRGYEEGVDKLAFNVETGPCPVETSGTRSHFALTDFPEEGTWSAV
VQQQDGAALCVSLCSPATACVGRYSLTLEASTDYQGSTFHIGDFVLLFNAWHPEDTVYLR
DXXXXXXXEYVLSQQGLIYQGARDYITSTPWNFGQFEEDILAICLNLLDTNPKFLRDQNR
DCSRRNDPVYIGRVACTVMRCLGVPSRVVTNYNSAHDTNGNLVIDRYMNETGVEERRSKD
MIWNFHCWVESWMARPDLAPGYDGWQALDPTPQEKSEGVYCCGPAPVKAIKEGDLQLKYD
IPFIFAEVNADVVYWIVQRDGSQGSQRKSTHSSVVGKNISTKSVGRDSREDITHNYKYPE
GSEKEREVFSKAEHEKRSLSEGEEGLHVKIKLSEGANNGSDFDVFAVISNDTDTERVCRL
MLCARTASYNGTVGPECGMKDLLNLTLGPRTVQSVPLRILYEKYGPCLTQDNIIKVVALL
TEYETGDVVLAIRDVYIQNPEIKIRVLGEPMQNRKLVAEITLVNPLAVPLNNCVFVVEGA
GLTEGQRIKEL
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggggcacgtccacgtcccggggccgggatctctctccctgcaagggaaggcgct
gcaggggggagagcttcacccactgctgcctctgcagagctggtgctggagacgtgggac
ctgcagtgcgagagcaacggccgcgagcaccggacggcggagatgggcggccagcagctg
gtggtgcggcgcgggcagcccttcaccatcaccctgcacttctccggcaggggctacgag
gagggggtggacaaactggccttcaacgtcgagacggggccctgccccgtcgagacgtcg
ggaaccaggtcccactttgccctgaccgacttccccgaggaggggacgtggagcgcggtg
gtgcagcagcaggacggggccgcgctctgcgtctcgctctgctcccccgccaccgcctgc
gtcggccgctacagcctgacgctggaggcctccaccgactaccagggctccaccttccac
atcggggacttcgttctgctcttcaacgcctggcacccagaggacacggtctacctccga
gacnnnnnnnnnnnnnnnnnnnntgagtacgtgctgtctcagcaggggctcatctaccag
ggtgcccgggactacatcacctccaccccctggaactttggccagtttgaagaagacatc
ttggccatctgcctcaacctgctggacacaaaccccaagttcctgagggaccagaaccgg
gactgctcccgccgcaatgaccctgtttatatcggcagggtggcgtgtaccgtcatgcgc
tgcctgggcgtccccagccgggtggtgaccaactacaactcagcccacgacaccaacggc
aacctggtcatcgaccgctacatgaacgagacgggggtggaggagaggcgctccaaggac
atgatatggaacttccactgctgggtcgaatcctggatggcccggccggacctggcacct
ggctacgacgggtggcaggcgctggacccgaccccccaggaaaagagcgaaggggtttac
tgctgcgggccggcccccgtcaaggccatcaaggagggcgacctgcagctgaagtacgac
atccccttcatcttcgcggaggtgaacgccgacgtggtgtactggatcgtgcagcgcgac
ggctcgcagggctcgcagaggaagagcacgcactcctcggtggtggggaagaacatcagc
accaagagcgtgggcagggacagccgcgaggacatcacccacaactacaagtatccggag
gggtctgaaaaggagagagaggtgttttccaaggcagagcacgagaagaggtccctcagc
gagggcgaggaggggctgcacgtcaagatcaagctgtcggagggcgcgaacaacggctcc
gacttcgacgtcttcgccgtcatcagcaacgatacggacacggagcgcgtgtgcaggctc
atgctgtgcgctcgcaccgccagctacaacggcacggtgggccctgagtgcggcatgaag
gacctgctcaacctcaccctcgggccccgcacggtgcagagcgtgcccttgcgcatcctc
tacgagaagtacggaccgtgcctgacccaggacaacatcatcaaggtggtggccctcctg
accgagtacgagacgggtgacgttgtgctggccatcagggacgtctacatccagaacccg
gagatcaagatcagggttttaggggagccgatgcagaatcggaagctggtggcagagatc
acgctggtgaaccccctcgcggtcccgctgaacaactgcgtgttcgtggtggagggagct
ggcctcaccgaagggcagaggatcaaggagctgtaa

DBGET integrated database retrieval system