KEGG   Anas platyrhynchos (mallard): 101800639
Entry
101800639         CDS       T02816                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1 isoform X2
  KO
K04503  G1/S-specific cyclin-D1
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla04068  FoxO signaling pathway
apla04110  Cell cycle
apla04115  p53 signaling pathway
apla04218  Cellular senescence
apla04310  Wnt signaling pathway
apla04340  Hedgehog signaling pathway
apla04371  Apelin signaling pathway
apla04510  Focal adhesion
apla04530  Tight junction
Brite
KEGG Orthology (KO) [BR:apla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101800639 (CCND1)
   04340 Hedgehog signaling pathway
    101800639 (CCND1)
   04371 Apelin signaling pathway
    101800639 (CCND1)
   04068 FoxO signaling pathway
    101800639 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101800639 (CCND1)
   04115 p53 signaling pathway
    101800639 (CCND1)
   04218 Cellular senescence
    101800639 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101800639 (CCND1)
   04530 Tight junction
    101800639 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 101800639
NCBI-ProteinID: XP_012958115
Ensembl: ENSAPLG00000003808
UniProt: R0JP78
LinkDB
Position
5
AA seq 292 aa
MEHQLLCCEVETIRRAYLDANLLNDRVLQTMLKAEETCSPSVSYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSFEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLTKMPLAEDTKQIIRK
HAQTFVALCATDVKFISNPPSMIAAGSVVAAVQGLHLGNTNTFLSYQCLTHFLSQVIKCD
PDCLRACQEQIESLLESSLRQAQQHNVSSETKTVEDEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgctgtgctgcgaggtggagaccatccgacgagcctacctggatgcc
aacctcctcaacgacagggtgctgcagacaatgctcaaggcggaggagacctgctcgccc
tcggtgtcctacttcaagtgcgtgcagaaggaaatcttgccatatatgaggaaaatagtt
gccacttggatgctggaggtttgcgaggagcagaagtgcgaagaggaagttttccccttg
gcgatgaattacttggacagatttttgtcgttcgaacccctcaagaaaagccgcttgcaa
ttgctcggagctacctgcatgtttgtggcttccaaaatgaaggaaactattcctctgacc
gcagaaaaactgtgcatttacacagataactccatcagacccgacgaattactgcaaatg
gagctgctgctggtgaataagctgaaatggaatctggctgcaatgaccccccacgatttc
attgaacatttccttactaaaatgcctctggcagaggacaccaagcagatcatccgtaaa
catgctcagacttttgtggctctgtgcgctacagatgttaaatttatttcaaacccacct
tccatgatcgcagctggcagcgtggtagcagctgtacaaggcctgcatctggggaacact
aacactttcctctcctatcaatgcctcacacatttcctatcacaagttatcaaatgtgat
ccggattgtttacgagcctgccaagaacagatcgaatccctccttgaatccagtctacgc
caggcacagcagcacaacgtatcttcagaaacaaagactgtagaggatgaagcagacctt
tcctgcacacctactgatgtgcgagatgtgaacatttaa

DBGET integrated database retrieval system