KEGG   Anas platyrhynchos (mallard): 101801315Help
Entry
101801315         CDS       T02816                                 

Definition
(RefSeq) myeloperoxidase isoform X1
  KO
K10789  myeloperoxidase [EC:1.11.2.2]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00983  Drug metabolism - other enzymes
apla04145  Phagosome
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101801315
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101801315
Enzymes [BR:apla01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.2  myeloperoxidase
     101801315
Exosome [BR:apla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101801315
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 101801315
NCBI-ProteinID: XP_005015918
Ensembl: ENSAPLG00000010848
LinkDB All DBs
Position
29
AA seq 789 aa AA seqDB search
MIRAAAGLSCCPPATPKDLSLFLKYSWGNNCPSASGLLYRHGGAARDLLLIIRSVASQFS
SLLALFFAGMKAEILFPGLLVVLILFQAHVSSSYDLSKELSDASLLSSVFEAKKIVDSAY
KDTRDRIKKNLENDVLTPVELLRYFKQPVAGTRAAVRAADYMETTLTLLKEKLRWAVKGD
FNVTDMLTPAQLGMIFKASGCDQQNEEINCESSGRYRTITGKCNNRKNPLLGASNRALAR
WLPADYEDGVSIPHGWTEKKRVSGFPFPLVRKVSNEIVRFPPAQLKLDQQRSLMFMQWGQ
FIDHDLDFSPETPARVTFSGKVDCHTSCAKQPPCFPIKIPPNDPRVKNTRDCLPFIRSAP
ACDSGKAIREQINALTSFLDGSVVYGSEVPLANKLRDRTNQLGLLAVNRNFTDRGMAYMP
FDYMSKDPCLMVSKGAKIPCFLAGDSRANEMLELACMHTLFVREHNRLARGLKRLNPHWN
GEKLYQEARKIVGAMIQIITYRDYLPLLLGTSLQKWIPCYRGYNEAVDPRISNVFTLAFR
FAHASIPPFVGRLNKNYKPINPKLQLSKTFFGVWRIVKEGGIDPFLRNLMASKAKLMTQK
QMVVDELRDRMFEQVERIGFDLAALNMQRGRDHGLPGYISWRQFCRLSKPRGLKSLAQVL
KNHSLAKKFMQLYGTPKNIDIWIGALAEPFVKGGRVGPLMACLIGTQFRKIRDGDRFWWE
NKGVFTPRQRSSLAKISLSRIICDNTHISKVSRNIFQANSYPHSFVSCNQIPKLDLRAWK
SKKMEESTE
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgatcagggcagctgctgggctctcttgctgtcctccagctactccaaaggatttgagt
ctgtttttaaaatacagctggggaaataattgtccatctgcttctgggcttttgtataga
catgggggagctgctagggacttgctgctcataatcaggtccgtggcttctcagttttct
tcacttcttgcacttttttttgcagggatgaaggcagaaatcctcttcccagggttgctg
gtggtcctaatcctgttccaggcacatgtatcttcttcctatgatctgtccaaggagctg
tcagacgcatccctcctgagcagcgtgtttgaagccaagaagatcgtggattcagcctac
aaggacacacgtgaccgcataaagaagaacctggagaatgatgtcttgacccccgtagaa
cttctgagatatttcaaacagccagtggcagggactcgggctgctgtgcgggctgcagat
tatatggaaaccaccctgacccttctcaaggagaagctacgctgggccgtgaagggggac
ttcaatgtcacagacatgctcacaccagctcagctggggatgattttcaaggcaagcgga
tgtgaccagcagaatgaggaaataaactgtgaatcttctggccgctaccgaacgatcact
ggcaagtgcaacaacaggaaaaacccattactaggagcttcaaacagagccctggccaga
tggttgccagcagactatgaagatggtgtgtcaattccccatgggtggacagaaaaaaag
cgtgtctctggattcccctttccactagttcgaaaggtgtcaaatgagatcgtccgtttc
ccccctgcgcagctcaagctggaccagcagcgatcactcatgttcatgcagtggggtcag
tttattgatcatgaccttgatttcagtcctgaaaccccagccagagtcaccttcagtggc
aaagtggattgtcacaccagctgtgccaagcagcccccctgctttcccatcaagatccca
cctaatgacccacgagttaaaaacaccagagattgcctcccattcattcgctcagctcct
gcttgtgacagtggtaaagcaattcgagaacagatcaacgcgctcacctcctttctggat
ggcagtgtggtgtatggcagtgaggtgcctttggccaacaagctgagggatcggaccaac
cagctgggcttgctggctgttaatcggaatttcactgacaggggcatggcgtatatgccc
tttgactacatgtcaaaggacccctgtcttatggtcagcaagggagctaaaattccatgc
tttcttgcaggtgactctcgagcaaacgagatgctggagctggcgtgcatgcacacgctt
tttgtgcgggagcacaaccgcctggctagaggactgaagagattaaatccacactggaat
ggagagaagctctaccaggaggcacggaagattgtgggtgccatgatccagattataacc
tacagggactacctgcctcttttgctgggaacaagtttacagaaatggattccttgctac
cgaggctacaatgaggctgtggatcctcgcatatccaatgtcttcactctggctttccgt
ttcgctcatgcttcaattcccccatttgtgggccgattaaacaaaaattataagcccata
aatccgaaactgcaactcagcaaaaccttttttggtgtctggaggattgtgaaagaaggc
ggtatcgatcccttcctgcggaacctgatggccagtaaggccaagctgatgacacagaaa
caaatggttgtggatgaactccgggatcggatgtttgagcaggttgaaaggattgggttt
gatttggctgcacttaacatgcagcgtggcagagatcatggccttccaggttacatctcc
tggagacaattctgtaggctctcaaaacctcgtggtttgaagtcacttgctcaagtattg
aagaatcacagtctggcaaagaaattcatgcagctgtatgggacaccaaagaatattgac
atttggattggggcgcttgcagagccctttgtgaaaggtggaagagttggtcctctcatg
gcttgtctaattggcacccagttcaggaagatacgtgatggggacaggttttggtgggag
aataaaggagttttcactcctcggcagcgcagttcactggctaaaatctccttgtcacga
ataatatgtgataatacccacatctctaaagtgtcaagaaatatcttccaggccaacagc
tatcctcactcctttgtgagctgcaaccagatcccaaagctggacctcagagcttggaag
tcaaagaagatggaagaaagtacagagtaa

DBGET integrated database retrieval system