KEGG   Anas platyrhynchos (mallard): 101801641
Entry
101801641         CDS       T02816                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla04010  MAPK signaling pathway
apla04060  Cytokine-cytokine receptor interaction
apla04068  FoxO signaling pathway
apla04144  Endocytosis
apla04218  Cellular senescence
apla04350  TGF-beta signaling pathway
apla04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:apla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101801641
   04350 TGF-beta signaling pathway
    101801641
   04068 FoxO signaling pathway
    101801641
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101801641
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101801641
  09143 Cell growth and death
   04218 Cellular senescence
    101801641
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101801641
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:apla01001]
    101801641
Enzymes [BR:apla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     101801641
Protein kinases [BR:apla01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   101801641
SSDB
Motif
Pfam: ecTbetaR2 Pkinase PK_Tyr_Ser-Thr Pkinase_fungal
Other DBs
NCBI-GeneID: 101801641
NCBI-ProteinID: XP_027318138
LinkDB
Position
7
AA seq 688 aa
MRAVGIRSPPKLPGLLGAAQCRRWRNQTLFPEPELFPQLPPSHICIYFMRRTGLSFFMSC
SSWADPTHSWVCCAWVRLPSQPSQQPRKFGAAELTAARQESREDERVNTVKPGSWSLAIQ
KMGCWRRPGLLSLLLLSFSWCAGARRSLKTNLCKWCDSTPPACEQEVCYSNCNLNSYCED
PYEICVAIWRQDNDSIRISTLCHNPHRPIENLMVPNYNTSRCIMTHQPSEEGIIYICGCV
DEQECNDKLIFENHTNGYSMLQSKEVIPVAAISLLPPLLVAVMITVIFYLCRTQKRRKRA
KAWGGKQGQPPALPEPGRAAERDEKLSVMMDDGPAGLSPTCANSLNHNTELLPIELDEMV
GKGQFAEVWRAKLNHSSSGQYETVAVKIFPCEEYSSWKNESQIFTDASLKHDSVLQFLTA
EDRGSGPRREYWLITAYHSRGNLKDYLSSHVLSWMDLQKMAGSLVNGVAHLHSDYTACGR
PKIPIAHRDIKSTNVLVKNEQECVLCDFGIAIRLDPSLTVDDFANSGQVGTARYMAPEVL
ESRVNLEDLESFKQMDVYSMALVLWEMASRCEVVGEVKNYELPFGSKVQEQPCVDTMRDI
VLHGRGRPEIPSSWLVHQGMRFLCDTITECWDHDPEARLTAHCVAERFNLMAQMDCDDIL
NNNTDSEADKTASPGGEHQDSDGSRNVQ
NT seq 2067 nt   +upstreamnt  +downstreamnt
atgcgggcagtaggcatcaggtcccctccgaagctccctgggctgctcggagcagctcag
tgccgtcgttggagaaatcaaacccttttcccggagccagagctcttcccccagctcccc
ccctcccatatctgtatatatttcatgaggagaacggggctgagtttcttcatgagctgc
agttcctgggcggaccccacgcacagctgggtttgctgcgcctgggtccgccttcccagc
cagcccagccagcagcctcgcaaattcggggctgccgagttgacagcagcgaggcaggag
agccgggaagatgaacgggtcaacaccgtgaagccgggctcctggtcgctggcgatccag
aaaatgggttgctggaggagaccgggtctgctttccttgctgctgctgtccttctcctgg
tgtgccggtgcccgccgcagcctgaagaccaacctgtgcaagtggtgcgactccacgccg
ccggcctgcgagcaggaggtgtgctacagcaactgcaacctcaactcctactgcgaggac
ccctacgagatctgcgtggccatatggagacaggacaacgacagcatcaggatcagcacg
ctctgccacaacccacaccgtcccatagaaaacctcatggtcccgaactacaacacctcg
cgctgcatcatgacccaccagcccagcgaggaggggatcatctacatctgtggctgcgtg
gacgagcaggagtgcaatgacaagcttatatttgaaaaccacaccaacggctactccatg
ctgcagagcaaggaggtcatcccggtggccgccatcagcctcctgccgccgctgctggtg
gcggtgatgatcaccgtcatcttctacctctgccgcacgcagaagcgccgcaagagggcc
aaggcgtggggtgggaagcaggggcagcccccggcgctgccggagccgggcagggcggcg
gagcgggacgagaagctgtccgtgatgatggacgatggccctgccggcttgagcccaacc
tgcgccaacagcctgaaccacaacaccgagctgctgcccatcgagctggacgagatggtg
ggcaaagggcagttcgccgaggtgtggagggccaagctgaaccacagcagctcggggcag
tacgagacggtggcggtgaagatcttcccctgtgaggagtactcctcctggaagaacgag
agccagatcttcacagacgccagcctcaagcatgacagcgtcctgcagttcctcacagcc
gaggaccggggctcggggccccgcagggagtactggctcatcacggcctaccacagccgg
ggcaacctcaaggactacctgtccagccacgtcctcagctggatggacctgcagaagatg
gcggggtcgctggtcaacggggtggcccacctccacagcgactacaccgcctgcggccgg
ccgaaaatccccatcgcccaccgggacatcaaaagcaccaacgtcctggtgaagaacgag
caggagtgcgtgctctgcgacttcggcatcgccatacgcctcgacccttccctgacggta
gatgactttgccaacagcgggcaggtgggcaccgccaggtacatggctcctgaggtgctg
gagtccagggtgaacctggaagacctggagtccttcaagcagatggacgtctactccatg
gccctcgttctgtgggagatggcctccagatgtgaagtggtgggagaggtaaagaattac
gagctgccttttgggtcaaaagtccaggagcagccctgcgtggacaccatgagagacatc
gtgctgcatggcagagggcggcctgagatccctagcagctggctggtacatcaggggatg
cgttttctgtgcgacaccatcaccgagtgctgggaccacgaccccgaggctcgcctcacc
gcccactgcgtggccgagcgcttcaacctgatggcacaaatggattgcgacgacatcctc
aacaacaacacggacagcgaggctgacaaaacggcctccccgggcggggagcaccaggac
agcgacgggagcagaaacgtgcagtga

DBGET integrated database retrieval system