KEGG   Anas platyrhynchos (mallard): 101802065Help
Entry
101802065         CDS       T02816                                 

Gene name
ACE
Definition
(RefSeq) angiotensin-converting enzyme isoform X2
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
apla  Anas platyrhynchos (mallard)
Brite
KEGG Orthology (KO) [BR:apla00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:apla01002]
    101802065 (ACE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:apla04147]
    101802065 (ACE)
   04090 CD molecules [BR:apla04090]
    101802065 (ACE)
Enzymes [BR:apla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     101802065 (ACE)
Peptidases [BR:apla01002]
 Metallo Peptidases
  Family M2
   101802065 (ACE)
Exosome [BR:apla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101802065 (ACE)
CD molecules [BR:apla04090]
 Proteins
  101802065 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Peptidase_M32
Motif
Other DBs
NCBI-GeneID: 101802065
NCBI-ProteinID: XP_012963792
Ensembl: ENSAPLG00000014288
LinkDB All DBs
Position
28
AA seq 1162 aa AA seqDB search
MPFPSPQYNTILSDMDKIYSTAKVCPTNDTCWELEPDLSDIMATSRSYKKLLYAWEGWHN
AAGNLLRAKYEEFVQLSNEAYRMDGFEDTGSYWRSWYDSASFEDDLEHLYNQLEPLYLNL
HAFVRRKLYDRYGPKYVNLKGPIPAHLLGNMWAQQWNNIYDLMVPYPEKPNLDVTSTMVE
QGWNATHMFRVSEEFFTSLGLLKMPPEFWDKSMLEKPTDGREVVCHASAWDFYNRKDFRI
KQCTTVTMEQLFTVHHEMGHVQYYLQYKDQPVSFRSGANPGFHEAIGDVMSLSVSTPSHL
KEIGLLSSATEDAESNINYLLKMALEKIAFLPFGYLIDQWRWNVFNGHTPPSRYNYDWWY
LRTKYQGICAPISRNESNFDPGAKYHIPGNTPYIRYFVSFILQFQFHKALCQAANHTGPL
HTCDIYKSTEAGAKLREVLEAGSSKSWQEILFNLTGTDKMDAGALLEYFSPVTTWLEEQN
SKTNEVLGWPEFDWRPPVPEGYPEGIDKIADEAQAKEFLAEYNRTAEEVWNAYTEASWTY
NTNITDYNKEIMLDKNLAMSKHTLEYGMRARQFDASDFQDQTVTRILKKLSVIERAALPE
DELKEYNTLLSDMETTYSVAKVCRENKTCHPLDPDLTDILAKSQDYDELLFVWKGWRDAS
GKKMRNNYKRYVELSNKAAVLNGYTDNGAYWRSLYETSTFEEDLEKLYLQLQPLYLNLHA
YVRRALYKKYGAEHINLKGPIPAHLLGNMWAQSWSNIFNLVVPYPDATKVDATPAMKEQG
WTPKMMFEESDRFFTSLGLIPMPQEFWDKSMIEKPTDGREVVCHASAWDFYNRKDFRIKQ
CTVVNMDDLITVHHEMGHVQYFLQYMNQPISFRDGANPGFHEAIGDVMALSVSTPKHLHS
IKLLDQVTENEESDINYLMSVALDKIAFLPFGYLMDQWRWKVFDGRIKEDEYNQQWWNLR
LKYQGLCPPTPRSEDDFDPGAKFHIPANVPYIRYFVSFVIQFQFHQALCDAAGHTGPLHK
CDIYQSKEAGNLLGEAMKLGFSKPWPEAMQLITGQPNMSAEALMSYFQPLMTWLVKENKK
NGEVLGWPEYDWTPYTAAQSQAGSSDRTDFLGMSLNSKQASAGGWVLLALALVFVITTIF
LGVKLSSARRKAFKSSSEMELK
NT seq 3489 nt NT seq  +upstreamnt  +downstreamnt
atgccttttccctccccgcagtacaacaccatcctgagcgacatggacaaaatctactcc
acggccaaggtgtgcccgaccaacgatacctgctgggagctggagccagacctctcggac
atcatggccacgtcccgcagctacaagaagctcctgtacgcctgggagggctggcacaac
gccgcaggaaacctgctgcgtgccaagtacgaggagttcgtgcagctgagcaacgaggcg
taccggatggacggcttcgaggacacgggcagctactggcgctcctggtacgactcagcc
tccttcgaggatgacctggagcatctctacaaccagctggagccgctctacctcaacctg
cacgcctttgtccggaggaaactgtacgaccgctacggccccaaatacgtcaacctgaag
ggtcccatccctgcccacctcctgggcaacatgtgggctcagcagtggaacaacatctac
gacctgatggtcccctaccctgagaagcccaacctcgatgtgacgagcaccatggtggaa
cagggctggaacgccacccacatgttccgggtctcggaggagttcttcacctccctgggg
ctgctgaagatgccccctgagttttgggacaagtccatgctggagaagccgacggacggg
cgggaggtggtgtgtcacgcctcggcctgggatttctacaaccgcaaggacttcaggatc
aagcagtgcacaacggtgaccatggagcagctgttcaccgtgcaccacgagatgggccac
gtgcagtactacctgcagtacaaggaccagcccgtctccttccgcagcggggccaacccc
ggcttccacgaggccatcggagatgtcatgtccctgtccgtctccacccccagccacctc
aaggaaatcgggctcctcagcagcgccaccgaggacgcggagagcaacatcaactacctg
ctgaagatggccttggagaagatcgccttcctgccctttggctacctcatcgaccagtgg
cgctggaacgtgttcaatggccacacgccccccagtcgttacaactacgactggtggtat
ctgagaactaaataccagggtatttgtgctccaatttcgaggaacgaaagcaacttcgac
cctggggcaaagtaccacatccctgggaacaccccttacatcaggtactttgtgagcttc
atcctccagttccagtttcacaaggcgctgtgccaggcggccaaccacactggtccccta
cacacctgtgacatctacaagtccacagaggctggagccaaactcagggaggtgctggaa
gctgggtcttccaagtcatggcaggaaatcctgttcaacctcactggcacggataagatg
gacgctggggccctcctggagtacttcagccctgtcaccacctggctggaggagcagaac
agcaagaccaatgaggtgctgggctggccagagttcgactggcgtccccctgtccctgaa
ggctaccccgaaggcattgacaaaatagcagatgaggcacaagctaaagagttcttggcc
gagtacaacaggacggccgaggaggtgtggaacgcctacactgaggcgtcctggacctac
aacaccaacatcaccgactacaacaaggagatcatgctggataagaacttggccatgtcc
aagcacacccttgagtacgggatgagagccaggcagttcgacgcctccgacttccaggac
caaactgtcacacgcatcctcaagaagctgagcgtcatcgagagggcagccctgcctgag
gacgagctgaaggagtacaacacccttctctcagatatggagaccacatacagcgtagcc
aaggtctgcagggagaacaaaacctgtcaccccctggatcctgacctcacggacatcctg
gccaagtcacaggactatgacgagctcctctttgtctggaagggctggcgggatgcttct
gggaagaaaatgaggaacaactacaagcgatacgtggaactgagcaacaaggcagctgtg
ctcaacggctacacagacaacggggcttactggagatccctgtacgagacatccaccttc
gaggaagatctggagaagttgtacctgcagctgcagcccctgtacctcaacctgcatgcc
tatgtacgccgggccctatacaaaaagtatggagctgagcacataaacctgaagggtccc
atccctgctcacctgctaggcaacatgtgggcccagtcatggtccaacattttcaacctg
gtggtgccctacccagatgccaccaaggtggatgccaccccagccatgaaggaacagggc
tggacacccaaaatgatgtttgaagagtcggaccgtttctttacctccctgggcctcatc
cccatgccgcaggagttctgggacaaatccatgatcgagaagccgacggacgggcgggag
gtggtgtgtcatgcctcagcatgggacttctacaaccgcaaggacttcaggatcaagcag
tgcactgtggtgaacatggatgacctgatcacggtgcaccacgagatgggccacgtccag
tacttcctgcagtacatgaaccagcccatctcattccgcgatggagccaaccctggcttc
cacgaggctattggggacgttatggccttgtccgtctccacccccaaacatctgcacagc
atcaagctgctggatcaagtcacagaaaacgaagaaagtgacattaactacctgatgagc
gtcgccctggacaaaatcgccttcctgcccttcgggtacctcatggaccagtggcgctgg
aaggtgtttgatgggcgcatcaaggaggacgagtacaaccagcagtggtggaacctcagg
ctgaagtaccagggcttgtgcccaccaacaccaaggtctgaagatgactttgaccctgga
gcaaagtttcacatccctgccaatgtcccctacatcaggtactttgtcagcttcgtgatc
cagttccagttccaccaggctctctgtgacgcagctgggcacacggggcccctgcacaag
tgtgacatctaccagtccaaggaggccgggaatctcttgggggaggccatgaagctgggt
ttcagcaagccgtggcctgaagccatgcagctcatcacagggcagcccaacatgtcagca
gaggccctgatgagctacttccagcccctcatgacatggctggtgaaggagaacaagaag
aatggggaggtcctgggctggcctgagtatgactggactccttacacggccgctcaaagc
caagctggctcctccgaccgaaccgatttcctgggcatgtccctgaacagcaaacaagcc
tcagcaggtggctgggtcctgctcgccctggcactcgtcttcgtgatcaccaccatcttc
ctgggcgtcaagttgtcctcggcaaggagaaaggccttcaaatccagctcagaaatggaa
ctaaaataa

DBGET integrated database retrieval system