KEGG   Anas platyrhynchos (mallard): 101802331Help
Entry
101802331         CDS       T02816                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00052  Galactose metabolism
apla00500  Starch and sucrose metabolism
apla01100  Metabolic pathways
apla04142  Lysosome
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101802331 (GAA)
   00500 Starch and sucrose metabolism
    101802331 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    101802331 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:apla04147]
    101802331 (GAA)
Enzymes [BR:apla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101802331 (GAA)
Exosome [BR:apla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101802331 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31
Motif
Other DBs
NCBI-GeneID: 101802331
NCBI-ProteinID: XP_012963511
LinkDB All DBs
Position
Un
AA seq 556 aa AA seqDB search
MSAPPAPRCALLQPQVNLYGSHPFYLVIEDGGSWVSAVEAPGHGAGPRPDPHLAPPVLAP
PPDVVLQPSPALTWRTTGGILDFYIFLGPDPKSVVRQYLDVVGFPFMPPYWGLGFHLCRW
GYSSTTTTRQADVQWNDLDYMDAKRDFTFNKETFKDYPDMVRDFHQRGLHYVMIVDPGIS
SSGPPGTYKPYDEGLKRGVFIRNATGQPLIGKVWPGPTAFPDFTNPKTHEWWHDMLKDFH
DQVPFDGMWIVSGLSPPSRALGCSXXACPRCLLSPAGVFGGRLQAGTICASSQQFLSSHY
NLHSLYGLTEAIASHDALLRIRGKRPFVISRSTFAGHGRYAGHWTGDVKSNWEQLSYSVP
EVLLFNLFGVPLVGADICGFLGDTLLWGGGLLVTPVLEAGQTKVSGYFPHGRADPXDLSF
LFFLXDSTIHSKGQWILLPAPLDTINVHVRAGHILPLQEPAFNGESWQSFEKGDYTETLF
LASHGAVLSQILRTRGHLDGILLEAVTVLGVTSPPRQVLANGARVPVDDFSYRSDTQVLR
VPVSLPMWEQFVITWS
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccccaccggcaccgcgctgtgctctgctccagccccaggtcaacctgtacggc
tcccaccccttctacctggtgatagaggacggcggctcgtgggtgagtgctgtggaggca
ccgggacacggggctggaccgaggcccgatcctcacctcgctcctccggtgctcgcgcct
cccccagacgtggtcctgcagccgagcccggccctgacgtggcgcacgacgggcgggatc
ctggacttctacatcttcctgggccccgaccccaagagcgtggtgcggcagtacctggac
gttgtggggttcccgttcatgcccccgtactggggcctgggcttccacctctgccgctgg
ggctactcctccaccaccaccacccggcaggccgacgtgcagtggaacgacctggactac
atggatgctaagagggatttcaccttcaacaaggagacctttaaggactacccggacatg
gtgcgggatttccaccagcgaggcctgcactacgtgatgatcgtggaccccgggatcagc
agctcggggcctccaggcacctacaagccctacgacgaaggactgaagcgaggggtgttc
atccgaaatgccacggggcagcccctcatcgggaaggtgtggccgggcccgacggctttc
ccagacttcaccaatcccaagacgcacgagtggtggcacgacatgctgaaggacttccac
gaccaggtgcccttcgatggcatgtggattgtgagtggcctttccccccctagcagagct
ctgggctgcagcnnnnnngcttgccctcgctgcctcctctcccctgcaggtgtgttcggg
gggcgcctccaggcaggaaccatttgtgcctccagccagcagttcctctcctcgcactac
aacctgcacagcctgtacgggctgaccgaggccatcgcttcccacgacgctctgctgagg
atccggggcaagcgtcccttcgtcatctcacgctccaccttcgctgggcacggccgctac
gctgggcactggacgggggacgtcaagagcaactgggagcagctgtcctactccgtgcca
gaggtgctgctcttcaacctcttcggggtgccgctggtgggtgccgacatctgcgggttt
ttgggcgacacactcctgtggggcggggggctgctcgtcacgccggtgctggaggcagga
cagaccaaagtcagtggctacttcccccatgggcgtgctgacccctgagacctgtccttt
cttttttttctttaggactcgaccatccacagcaaaggccagtggatcctcttgccagct
cccctggacaccattaacgtgcacgtccgagcagggcacatcctgcccctgcaggagcct
gcgttcaatggggagagctggcagagcttcgagaagggggactacaccgagaccctcttc
ctggcctcacacggcgccgtgctcagccagatcctgcggactcgcggccaccttgacggg
atcctgctggaggctgtgaccgtcctgggggtcaccagccctccccggcaggtcctggcc
aacggtgcccgngtgcccgtggatgacttctcctaccgcagtgacacccaggtgctgaga
gtccccgtgtcgctgccgatgtgggagcagtttgtgatcacttggtcctga

DBGET integrated database retrieval system