KEGG   Anas platyrhynchos (mallard): 101803779Help
Entry
101803779         CDS       T02816                                 

Gene name
GAMT
Definition
(RefSeq) guanidinoacetate N-methyltransferase isoform X1
  KO
K00542  guanidinoacetate N-methyltransferase [EC:2.1.1.2]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00260  Glycine, serine and threonine metabolism
apla00330  Arginine and proline metabolism
apla01100  Metabolic pathways
Module
apla_M00047  Creatine pathway
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    101803779 (GAMT)
   00330 Arginine and proline metabolism
    101803779 (GAMT)
Enzymes [BR:apla01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.2  guanidinoacetate N-methyltransferase
     101803779 (GAMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spore_YabQ
Motif
Other DBs
NCBI-GeneID: 101803779
NCBI-ProteinID: XP_027328404
LinkDB All DBs
Position
20
AA seq 329 aa AA seqDB search
MAHPHCMVLVHGTVPTSPPSHPGPPNRTWAPLARPPLSPPSPIRQPFHPKGAPARRAHSA
LSQPRLFKAGRAPGALSLPQHRRALGLSSRGTMSAHPAAAPIFADGEDCRQAWRGATAAY
DAPDAHLEILGKPVMERWETPYMHSLAAVAASRGGRVLEVGFGMAIAATKLEEFDIEEHW
IVECNEGVFRRLEEWARAQPHKVVPLKGLWEDVVPTLPDGHFAGILYDTYPLSAKTWHTH
QFAFIKDHAFRLLQPGGVLTYCNLTSWGELLKTKYTDIEKMFEETQVPHLVEAGFKKENI
STTVTDLVPPKDCRYYSFHKMITPSVVKH
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggcacaccctcattgcatggtcctggtgcacggcacagtccccacgtccccccccagc
caccccggaccacccaaccgcacgtgggcaccactcgcccggcccccactgtcccctccc
agcccgataaggcagccctttcacccaaaaggggccccagcccgccgtgcacactcagct
ctttcccagccccggctatttaaagccggccgagcgcccggagccctctccctcccccag
caccgccgagcccttggactttcctcccgcgggaccatgagcgcccacccggccgcagca
cccatctttgcggatggcgaggattgccggcaggcctggcggggggcgacggccgcctac
gacgcccccgacgcccacctggagatcctggggaagccggtgatggagcgctgggagacc
ccctacatgcactcgctggcggccgtggccgcctccaggggcggccgcgtgctggaggtg
ggcttcggcatggccatcgccgccaccaagctggaggagttcgatatcgaggagcactgg
atcgtggagtgcaacgagggcgtcttccggcggctggaggagtgggccagggcgcagccg
cacaaggtggtgccactgaaggggctgtgggaggacgtggtgccaacgctgccggacggg
cactttgctggaatcctgtacgacacctacccgctgtcggcaaagacctggcacacgcat
cagttcgccttcatcaaggaccatgccttccgcctgctgcagcccggcggggtcctcacc
tactgcaacctcacctcctggggagagctgctgaagaccaagtacaccgacatcgagaag
atgtttgaggagacccaggttccgcacctggtggaggccgggttcaagaaggagaacatc
agcaccacggtcacggacctcgtcccccccaaggactgccggtactactccttccacaag
atgatcacccccagcgtggtgaagcactga

DBGET integrated database retrieval system