KEGG   Anas platyrhynchos (mallard): 101804181Help
Entry
101804181         CDS       T02816                                 

Gene name
PFKP
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00010  Glycolysis / Gluconeogenesis
apla00030  Pentose phosphate pathway
apla00051  Fructose and mannose metabolism
apla00052  Galactose metabolism
apla01100  Metabolic pathways
apla01200  Carbon metabolism
apla01230  Biosynthesis of amino acids
apla03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101804181 (PFKP)
   00030 Pentose phosphate pathway
    101804181 (PFKP)
   00051 Fructose and mannose metabolism
    101804181 (PFKP)
   00052 Galactose metabolism
    101804181 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    101804181 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:apla01009]
    101804181 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:apla03019]
    101804181 (PFKP)
Enzymes [BR:apla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     101804181 (PFKP)
Protein phosphatases and associated proteins [BR:apla01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101804181 (PFKP)
Messenger RNA biogenesis [BR:apla03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     101804181 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 101804181
NCBI-ProteinID: XP_027306273
Ensembl: ENSAPLG00000012725
LinkDB All DBs
Position
2
AA seq 786 aa AA seqDB search
MDHQPKFFENLSGTGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVKAKVYFVYEGYQGMVD
GGDNIVEVSWESVSSILQVGGTVIGSARCKSFRTREGRLQAAYNLVQRGITNLCVIGGDG
SLTGANLFREEWSGLLEELAQKGKIDQEAVKKYAYLNIVGMVGSIDNDFCGTDMTIGTDS
ALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPEYPPEEGWE
DSMCVKLSENRARKKRLNIIIVAEGAIDCHNKPITSEKVKDLVVQRLGFDTRVTILGHVQ
RGGTPSAFDRILASRMGVEAVLALLEGTPDTPACVVSLSGNQAVRLPLMECVQMTQEVQK
AMDEGRFVEAVRLRGRSFENNLNTYKLLSHKKPDAELPKTNFNVAVLNVGAPAAGMNAAV
RAAVRVGITEGHKMFAVIDGFEGFSRGKIKEISWGDVGGWTGQGGSILGTKRTLPAKYLE
KIADQMRTNNINALMVIGGFEAYLGLLELSAAREKYDEFCVPMVMVPATVSNNVPGSDFS
IGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGALAAGADAAYIFEEQ
FDIRELQANVEHLTEKMKTSIQRGLVLRNENCNENYTTDFIYQLYSEEGKGVFDCRKNVL
GHMQQGGAPSPFDRNFGTKISAKAMQWISKKLKETYRKEEGKVFANTDDSVCLLGMRRRN
LVFQPVAELKNETDFVHRIPMEQWWLKLRPLMKILAKYKTSYDVSDSGQLEHVAMHSPKE
AETGAI
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atggatcaccagcccaagttcttcgagaacctctcgggcaccgggaaagccatcggcgtg
ctcaccagcggcggcgatgcccagggtatgaatgctgctgtacgtgcagtggtacgcatg
ggaatctatgtaaaagccaaagtctattttgtttatgagggttaccaaggaatggttgat
ggaggtgataatattgttgaagtttcatgggaaagcgtttcaagtatcctgcaagtagga
ggtacggttattggtagtgcacggtgcaaatccttccgtactcgggagggccgcctgcag
gcagcctacaacttggttcagagaggaatcactaatctgtgtgtgatcggtggagatggt
agtttaactggtgccaatctgttccgtgaagaatggagtggacttctagaagaactagca
cagaaaggaaagattgatcaagaggctgttaagaaatatgcttatcttaacattgtggga
atggttggatccatagataatgacttctgtggcactgatatgaccataggtactgactcc
gccttgcacagaatcattgaagtcgtggatgccatcatgaccactgctcaaagccatcag
aggacgtttgttctggaggttatggggagacactgtgggtatttagctcttgtcagtgcc
ttagcttgtggtgcagattgggtatttattcctgaatacccaccagaagaaggatgggag
gattcaatgtgtgttaagctttcagagaatcgtgcacgaaagaaaaggctgaatattatt
attgtagctgaaggagctattgattgccacaacaaacctataacatcagagaaggttaag
gatcttgtggttcagcggcttggatttgacactcgtgtgactatcttgggtcatgtgcaa
agaggaggaaccccttcagcctttgacagaatcctggcaagccgtatgggtgtagaagct
gtgcttgcccttttagaaggcactccagatactcctgcctgcgttgtgtcgctgtctgga
aaccaggctgtccgtctgcctttgatggagtgtgtgcagatgactcaagaagtacagaaa
gccatggatgaaggaagatttgttgaggctgtgaggcttcgtggaaggagctttgaaaac
aaccttaacacctacaagttattgtcacacaaaaaaccagatgctgagcttccaaagact
aattttaatgtggcagtcttaaatgttggtgctcctgcagctggaatgaatgctgcagta
agggctgcagtgagagttggcataactgaaggccataaaatgtttgctgtcattgatgga
tttgaaggtttttctagagggaagataaaggaaatcagctggggagatgttggaggctgg
actggccagggaggatcgattcttggtaccaaacgtactcttcctgctaagtatttggag
aagatcgctgaccagatgcgcactaacaacattaacgctcttatggttattggtggattt
gaggcgtacctcggactcctggaattgtcagctgcccgagagaaatatgacgaattctgt
gttccaatggttatggttcctgcaacagtatccaacaatgtaccgggttcagatttcagc
attggtgcagatactgctctgaacactataactgatacatgtgatcgcatcaaacagtca
gctagtggtaccaaacgtcgtgtattcatcattgagaccatgggcggttattgtggatac
ctggccaatatgggggcccttgcggcaggagctgacgctgcttatatttttgaagaacag
tttgatattcgagagctccaggctaatgtggaacacttaactgaaaagatgaaaaccagt
atccagcgtggtctagtgctgagaaatgagaactgcaatgagaactacacaactgacttc
atctatcagctgtattctgaagaaggaaaaggagtgtttgactgtcgaaaaaatgtattg
ggccacatgcagcagggtggtgcgccttcgccatttgatagaaactttgggacaaaaatt
tctgcaaaagctatgcagtggatctccaaaaagctgaaagaaacctacaggaaagaagaa
ggaaaagtatttgccaatactgatgactcagtctgtctgctgggaatgcgtagacgcaac
cttgttttccaaccagtggctgagctgaagaatgaaacagactttgtacataggattccc
atggagcaatggtggctgaagctgagaccactgatgaaaatcctggccaaatacaagacc
agctatgatgtttcagattcaggccagctggagcatgttgctatgcacagcccaaaggaa
gcagaaaccggagccatctaa

DBGET integrated database retrieval system