KEGG   Anas platyrhynchos (mallard): 101804455
Entry
101804455         CDS       T02816                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00220  Arginine biosynthesis
apla00330  Arginine and proline metabolism
apla01100  Metabolic pathways
apla04020  Calcium signaling pathway
apla04146  Peroxisome
apla04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    101804455 (NOS2)
   00330 Arginine and proline metabolism
    101804455 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101804455 (NOS2)
   04020 Calcium signaling pathway
    101804455 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101804455 (NOS2)
Enzymes [BR:apla01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     101804455 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 101804455
NCBI-ProteinID: NP_001297322
Ensembl: ENSAPLG00000016213
UniProt: F0UYP7
LinkDB
AA seq 1148 aa
MLCPWQFAFKPHAAKNRSSKVTDINNNVEKDMKINGLVKDDAKLHDLIKKQKEKLPIVTS
AEKPPENGIKASNQISRCPRHVKVRNLENGSSFLDTLHLTAKEVINCRTKACQGALMTPK
GLVRGTRDGPVPQAELLPQAIDFVKQYYSSFKESKIEEHLARLETVTKEIETTGTYHLTQ
DELIFAAKQAWRNAPRCIGRIQWSNLQVFDARDCKTAKEMFEHICRHVQYATNNGNIRSA
ITIFPQRTDGKHDFRVWNSQLIRYAGYQMPDGSVLGGPASVEFTKLCIDLGWKPKYGRFD
VVPLILQANGQDPEIFEFPPKIILEVPMEHPKYEWFKELDLKWYALPAVANMLLEVGGLE
FTACPFNGWYMGTEIGVRDFCDVQRYNILKEVGRRMGLETNKLSSLWKDRAVVEINVAVL
YSFQKQNVTIMDHHSAAESFMKYMQNEYRVRGGCPADWVWIVPPMSGSITPVFHQEMLNY
VLTPFFYYQVDAWKTHIWHDESQRPMKREIKLSVLAKAVLFASSLMQKAMATRSKVTVIY
ATETGKSETLANNLCSLFSCAFNTKILCMDEYNISDLEKETLLLVVTSTFGNGDSPNNGK
TLKNSLLTLKLLEKKIRYAVFGLGSTMYPEFCAFAHAIDQKLAQLGASQLIPIGEGDELN
GQEEAFRTWAVSAFKTACDIFNIRGKNSIQLPKMYTSDEIWNPKKYRILHESQTMDLAKA
LTNIHGKDVIPMKLKFRQNLQSLKSSRVTILVKLSCETNQEVRYLPGEHIGIFPGNQPEL
VHGLISRVKDAPPADQTVRLETCTEGGYWTSDKKIPACTLSQALTYLLDITTPPSQQLLK
KISQLVTAEGDKQRLEVLCHNTEEYNKWKFYNSPNILEVLEEFPSAEVSTAFLLTQLPFL
KPRYCSVSSSCDMTPREIHLTVAVVNYRTRDGQGPLHHGVCSTWLNKISLNEVVPCFVRS
GNGFQLPKEPTKPCILIGPGTGIAPFRSFWQQRLYDLEKRGIKGGDMTLLFGCRQPDMDH
IYREETEEMKRKGVLKEVFTAYSRQPGQAKVYVQDILQNKLEAKVCNLLHKEDGHLYVCG
DVRMARDVAQTLKGILVKNLNLTEQQAEEYFFELKSQKRYHEDIFGAVFPHEVKRDVKAL
QPISPSTN
NT seq 3447 nt   +upstreamnt  +downstreamnt
atgctgtgcccatggcagtttgcattcaaacctcatgctgctaagaaccggtcctccaaa
gtgacggatatcaataataacgtggagaaagatatgaagatcaatggcttagtgaaagat
gatgccaaattgcacgatctaatcaagaagcagaaagagaagctgcctatcgtaacttca
gcagagaaacccccagaaaatggtatcaaagcttcaaaccaaatatcaagatgtccaaga
catgtaaaagtaagaaacttggaaaatggatccagctttcttgacacactacacctgaca
gcaaaggaggttatcaattgccgcaccaaagcatgccaaggggcacttatgaccccaaag
ggcttggtgaggggcactagagatgggccagttcctcaggcagagcttttacctcaggca
atagactttgtcaagcagtactacagttcatttaaagagtcaaaaatagaagaacacctg
gcccgactagaaacagtgaccaaagagatagaaacaacaggaacctaccatctgacacag
gatgaactgatctttgctgccaaacaggcctggaggaatgctccgagatgtattgggaga
atccagtggtccaatctacaggtattcgatgcacgtgactgtaaaacagccaaggaaatg
tttgagcatatctgtcgtcatgttcagtatgcaacaaacaatggaaacataaggtcagcc
atcactatcttcccacagaggactgacgggaagcatgatttccgtgtttggaacagccag
ctcatccgatatgctggatatcaaatgccagatgggtctgtcctaggaggccctgcaagt
gtggagttcacaaagttgtgcattgatcttgggtggaagccgaaatatggccgctttgat
gtagttccactcattctccaagcaaacggccaagatccagaaatatttgaattcccgcca
aaaattatccttgaagtgccaatggagcatccaaagtatgaatggtttaaggagttagat
ctgaaatggtacgcgctgcctgctgttgccaacatgctccttgaggtgggaggtctggaa
tttactgcgtgtcctttcaatggctggtacatggggacagagataggagtgcgagacttc
tgtgatgtgcagcggtacaatatcctgaaggaggtaggaagaagaatgggactggaaaca
aacaaactttcatcactatggaaagaccgagctgttgtagagataaatgtggctgtgctt
tatagcttccaaaaacaaaacgttactatcatggatcaccactcagctgctgaatccttc
atgaaatatatgcagaatgagtaccgtgtgcgaggaggctgccccgctgactgggtgtgg
attgtacctcctatgtcagggagcataactcccgtgttccaccaggagatgttgaactat
gtcctcactcccttcttttactaccaggtggatgcatggaaaacacacatctggcatgat
gagtctcagaggccaatgaaaagagaaataaaattgagtgtcttggcaaaggctgtactc
tttgcatcttcactcatgcaaaaagcaatggcaacaaggtccaaggtcactgtgatctat
gcaacagagactgggaaatctgaaacactagccaacaatctgtgcagcttgttcagctgt
gccttcaacactaagattctgtgcatggatgaatacaacatcagtgacctggaaaaagaa
acgcttcttttagtggttactagcacttttggaaatggagattctccaaataatggaaag
acattgaagaactccttgctcaccctgaaattgctggaaaagaaaattagatatgccgtg
tttggtttgggatctaccatgtatcctgaattctgtgcctttgctcatgccattgaccaa
aaactggcccaactaggggcttcacagctcattccaataggtgaaggagatgaactcaat
gggcaagaagaagcctttcgcacatgggcagtcagtgcattcaagactgcctgtgacatt
tttaacatccgtgggaaaaacagtattcagttgcctaagatgtatacctcagatgaaatc
tggaatcctaagaaatacaggatactgcatgagtctcaaaccatggacttggctaaagca
cttacaaacattcatggaaaggatgtaattcccatgaagctgaaattcagacagaatctt
cagagtttaaaatccagtcgcgttaccattctagttaagctttcctgtgagactaatcag
gaagtgcgctacctgcccggagaacatattgggattttcccaggcaaccagccagaactg
gtccatggcctcatttcacgtgttaaggatgcccctccagctgatcagactgtcagactt
gaaacctgcactgaaggtggctactggacaagtgacaaaaagattccagcctgcacactc
tcccaagctttgacatatttgcttgatatcactactccaccctcccaacaactgctaaaa
aagatttcccagctggtaacagcggaaggagacaaacagagactggaagttctatgtcat
aacacagaagaatacaataaatggaagttttacaacagcccaaacatcctggaggtcctg
gaagagtttccttctgctgaagtctcaacagctttcttgttgactcagctgccatttctg
aaacccaggtactgttctgtcagttcttcctgtgacatgacacccagagagattcatctg
acagttgcagtagtcaattacaggacaagagatggacaagggcctttgcatcatggagtt
tgcagcacatggctgaataaaataagtctcaatgaagtagtgccatgctttgtgcgcagt
ggtaacggattccagctcccaaaggagccaaccaagccctgcattctgatcggcccagga
acaggaattgctccattcagaagtttctggcagcaacgcctctatgacttggaaaagaga
gggatcaaaggtggtgacatgacattattgtttggctgccggcagccagacatggatcat
atctacagagaagaaacagaagaaatgaagaggaaaggagttctgaaagaagtttttaca
gcttactccaggcaacctggccaagctaaagtctatgttcaagacattcttcaaaacaag
ttggaagccaaagtgtgcaatctcttgcataaagaggatggacatctgtatgtctgtgga
gatgtacgcatggccagggatgttgctcagactttgaaagggatacttgtaaaaaatctg
aacctcacagagcagcaggcagaagagtatttcttcgagctaaagagccaaaaacgttac
catgaagatatatttggggctgtgttcccacatgaagtcaaaagagatgtaaaagctttg
caacccatcagtccaagcacaaattaa

DBGET integrated database retrieval system