KEGG   Anas platyrhynchos (mallard): 101804576
Entry
101804576         CDS       T02816                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X2
  KO
K05461  KIT ligand
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla04010  MAPK signaling pathway
apla04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:apla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101804576 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101804576 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:apla04052]
    101804576 (KITLG)
Cytokines and growth factors [BR:apla04052]
 Growth factors
  Growth factors (RTK binding)
   101804576 (KITLG)
SSDB
Motif
Pfam: SCF DUF1474
Other DBs
NCBI-GeneID: 101804576
NCBI-ProteinID: XP_005025123
Ensembl: ENSAPLG00000011383
LinkDB
Position
1
AA seq 285 aa
MDQCKTWIITCFCLQLLLLNPLVKAQSSCGNPVTDDVNDIAKLVGNLPNDYMITLKYVPK
MDSLPNHCWLHLMVPEFSRSLHSLLQKFSDISDMSDVLSNYSIINNLTRIINDLMACLAF
DKNKDFIKENGHLYEEHRFFPEQFFEVFNSTIEVYKEFADTLDKNDCILPSTVETPENDS
RVAVTKTILFPPVAASSLRNDSTGSNTSSNKEALGFISSSSLQGISIALTSLLSLLIGFI
LGAIYWKKTHPKSRPESDETTECHGCQEENEIRMLQQKEKEHLQV
NT seq 858 nt   +upstreamnt  +downstreamnt
atggaccaatgtaagacttggattatcacttgcttttgtcttcaactactcctacttaat
cctcttgtcaaagcccagagttcctgcgggaatccagtgacagatgatgtaaatgacatt
gcaaaattggttggaaatctgccaaatgattatatgataacccttaaatatgtcccgaag
atggatagcttgcctaatcactgttggttgcatttgatggtgcctgaattttcaaggagt
ctacatagtcttctccagaaattttctgatatttccgatatgtctgatgttttaagcaac
tattcaatcatcaataatctcacaaggataattaatgatcttatggcatgtctagctttt
gataaaaataaggattttataaaagaaaatggtcacctttatgaagaacatcgcttcttt
cctgagcagttttttgaggtctttaatagtaccattgaggtttacaaggagtttgcagac
acattggataagaatgactgtattctgccttcaacagtagaaacaccagagaatgattcc
agagtcgctgtcacaaaaacaattttgtttcctcctgttgctgccagctcccttaggaat
gacagcactggcagtaacactagcagtaacaaagaggcacttggcttcattagcagctcc
agccttcaagggatcagcatagcattgacatcattactgtctcttcttattggctttatt
ttgggagccatatattggaagaaaacacatcccaaatccagaccagagagtgatgaaact
acagagtgtcatggctgtcaagaggaaaatgagataaggatgttgcagcagaaagaaaaa
gaacatctacaagtgtag

DBGET integrated database retrieval system