KEGG   Anas platyrhynchos (mallard): 101805218Help
Entry
101805218         CDS       T02816                                 

Gene name
SETD2
Definition
(RefSeq) SET domain containing 2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101805218 (SETD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:apla03036]
    101805218 (SETD2)
Enzymes [BR:apla01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101805218 (SETD2)
Chromosome and associated proteins [BR:apla03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101805218 (SETD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET AWS WW
Motif
Other DBs
NCBI-GeneID: 101805218
NCBI-ProteinID: XP_012958658
Ensembl: ENSAPLG00000004917
LinkDB All DBs
Position
Un
AA seq 2415 aa AA seqDB search
MLTPSFSVFFCMFSRLDCNREEENEGKTETVQKAGFIKGPVFKGVASSRFLPKGTKTKVN
LEEQGRQKVSFSFSLTKKTLPNRFLTGLGNEKQNETQNSPAVPLQTEFNPKIKMDLGDAA
GSAEESSPPKPKVELGKIHFKKHLLSVTTKPPPPAAAVTLPPSALAPVTEPVAAAADFPS
TPPPPPPPPPTASPAASMPVPAAAALPQLPVTLMSTLLLSPPVEAEVPASKEPCRVVPKE
ALELDVKQDAVSHGLEEHVTVHTAEQVEITPQKEDSHIGKDDEVADSSKGASLCSRKQGS
KRKFSQSDGALLGSESDEDSVRTSSSQRSHELKISSAEKERDPRKSSASLRGEELVKSSS
RSKSDRDEKYSSYSKSERDSRYSSSRSRSDRDRRRSRSHSRSRSDRGSRTSSSYSRSERS
HYYESDRRYHRSSPYRERTRYSRSYADSRARESSDSEDEYRRTHSRSSDSRRTSSHSSSY
RDSRTSYSKSDRDSKIESSHGDMERRGKSSSKADRDSKRTSESEVTKRCSPLNELGYRKG
TSHSKPDSNVNSSRYKSTPSKTPAPKPDKFKSSFCCTESVEEIKQQSNSLDLETSCLKSN
EIRVSIAKRFEREKTLSPLNQLNDSPTFKKTDESKAGFPHSRSEEVAGNECHDSVKEQET
LVKVKHEQLRTCFPMEMNINGSPEGRSDDLATLSASKPEDVTVSSDDSLCRSEVSPVVKT
SKSYPLPSNGFESTYASKEHELGDSRVQSSECSSLFKETEAPVPEQQCEAMPLPVVNVDH
SKTLIKKLDDQATPCDKTKESVFCYISDDATPSLYHSEVEIEAEPADLKVTSEAFLDVHV
EPQTVTCDYESPEDQNSKSACEDDQYHMNHAHKTSLAVDSSSRDSSQDGYSPRIRLDNPM
VAQHPEGNVPSKWDRAPPSQCERPAHHSEAEEMLEVDTRHVDLPSAKGKLSFKDEHSYYS
ELPPEHRSREVVVEESAVSTEGLGSDDLKEQGLGTSIEDAGNGPLVASAFPDALFPSCDV
VVTAEETETLTQAPTCDSSGGASDFVPARHDDYSDTAESDSEAGSDDSETEDSDSDDGMP
RKRLQSVVVVPKNSTIAMEESSPCSSRSSQGNRRYSDHWDDERPEPSRPYYEERPENTTS
KNGLQAESRCSPRGMEKSPASSTELSRKEPEELRPDACQPQSDGVDSTSQADLAADSDGK
PNQDERLKELVSAGRPGGLQEEQPFCLPESLESADNSRHQTNASQPDSRQGKGGLNQSGL
GEFSKVDGFHTAEDLGGLGWDFSQPEKPSSTYQQPDSSFGVYSGYVYQPGSGAYGGSQNY
WQGNGYWDARSASRPSGINYERIQGQVPDSLTEDHEEYEEDDRWDDECKARFPSSPSKFH
APEQKEAGSVQAHEISSNSTKEPGSAGEKKEEVKALEKNDVKERGPPKKRRQELESDSES
DGDSRERKKVKAEGEQAEAAPQDSSMVGRLCIMDDFRDPQRWKEFAKQGKMPCYFDLIEE
NVYLTERKKNKSHRDIKRMLCECPPLSKEERAQGEVACGEDCLNRLLMIECSSRCPNGDY
CSNRRFQKKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYAR
NKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPS
GSELTFDYQFQRYGKEAQKCFCGSANCRGYLGGENRVSIRAAGGKMKKERSRKKDSVDGE
LEALLENGEGLSDKNQVLSLSRLMVRIETLEQKLTCLKLIQNTHSQSCLKSFLECHGLSL
LWIWMTELGDGRGSTANNLKLQLEIMKTLELLPIPTKNMLEESKVLPIIQRWAQTKTAVP
QLSEGDGYSSENTSRAHTPLNTPDLSAKQSVEGDTDTPKKLVFRRLKIISENSMDSAISD
TTSELEGKEGKEDLDQLEGAPTEASEEQQQQQEMKPAGDVPVESSKPQVVELEAEPEVEV
KESNGAKLEEPITMETPSQDEEEGVSDVESERSQEQTDKIVDVSDLATRLLDSWKDLKEV
YRIPKKSQAEKESSADRGREASGHRDQTPTPKNPVLSRERDPERQSQSKEKKRRRDSLSP
PSSAYERGTKRPEDRADCQNYGVWDSSQQAVAVQQQYSPAQSQPAIYYQGQTCQTVYGVT
SPYSQTTPPIVQSYAQPGLQYIQGQQIYTAHPQGVIVQPPTAVTTIVAAGQPQPIQQPEL
VVSNNLLDLPPPSPPKPKTIVLPPNWKTARDPEGKIYYYHVVTRQTQWDPPTWDSPGDDA
SLEHEAEMDLGTPTYDENPMKSSKKPKTAEADTSSELAKKSKEVFRKEMSQFIVQCLNPY
RKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIKKYMQ
KFGAIYKPKEDTDLE
NT seq 7248 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccccttctttctctgttttcttttgcatgttttcccggctggattgcaataga
gaagaagaaaatgagggcaagactgaaaccgtgcagaaagctggctttatcaaaggccca
gtgttcaaaggcgttgcttctagtcgctttttgcccaaaggcaccaaaacaaaggttaac
cttgaggagcagggaagacaaaaagtgtctttcagctttagtttaaccaagaaaacctta
ccgaacagatttctgaccggtctcggaaacgagaaacaaaatgaaactcagaactcccca
gcagtaccccttcagactgaatttaaccccaaaattaaaatggaccttggggatgctgct
ggttcagctgaggagtcctcacctcccaaaccgaaggtagaactggggaagatccatttt
aagaaacatttacttagcgtcactaccaaaccaccgccaccagctgcagcagtgacgttg
ccgccgtcggctctggcaccggtaacggaaccggtggcagcggccgcggacttcccgtca
acaccgccaccgccgcctccacctcctccaacagcatcaccagcagcatccatgccagtt
cccgcagcagcagccttgccacaactgcccgtaacgctcatgtcgacgctgctgctgtcg
ccgcctgtagaagcagaagtcccggcttcgaaggagccgtgtcgcgtggtgccgaaggag
gctttggagctggacgtcaagcaggatgcggtatcgcacggtttggaagagcacgtaacc
gtacacacggccgagcaggtggaaataactccacagaaggaagattcccatattgggaaa
gacgacgaggtggcagacagctccaagggtgcttctctgtgctctaggaaacagggttcg
aagaggaagttctcccagtccgacggcgcgttgctgggctccgagtctgatgaagactct
gtgaggacttcttccagccagcgctcgcatgaactgaagatatccagtgcggaaaaagag
agagatcccaggaaaagctctgcgtcgctcaggggagaagaactggtgaagtcctcctcg
cgctccaagtcggacagagatgagaagtactctagttattccaagtcggagcgagattcg
cggtactcgtcctcccggtcgaggtcagacagggacagacggcgaagccgctctcattct
cgttcccggtccgatcggggctcccgaaccagctcttcgtactcgaggtcggagcgctcg
cattactacgagtccgaccgcagataccaccggagctccccttacagagaaaggacaaga
tactctcgttcgtacgcggattcgagggcgagggagagctctgattcggaagacgagtac
aggaggacacattccagatctagcgactcgaggcgcacgtcgtcccactcctcttcgtac
agagattcaaggacttcttactctaagtcggacagggacagcaaaatagagtcatctcat
ggtgacatggagaggagaggaaagtcttcttcaaaagcagatagagattcaaaacggact
tcagaaagtgaagtaaccaaaaggtgctctccccttaatgagctcgggtatcgaaagggg
acatcccattctaagcctgacagtaatgtgaattcctcccgttataagtccaccccttca
aagacccctgcgccaaagcctgataaatttaagagttctttctgttgtacagaatcggtt
gaagaaataaagcagcagtctaattctctagatttagagacctcttgtctaaaaagcaat
gagatccgagtgtccattgcaaaaagatttgaaagggaaaagacactttctccattaaat
cagttaaatgattcacccacttttaaaaagactgatgaatctaaagctggttttcctcat
tcaaggtccgaggaagttgcaggaaatgaatgccatgacagtgttaaggagcaagagact
ttagtaaaggtaaagcacgagcagttaagaacgtgtttccctatggaaatgaatataaat
gggtccccagagggtaggtctgatgacttggcaactctcagtgcctccaaaccagaggat
gtcacagtgtcttctgacgatagcctgtgtaggtcggaagtgtcacccgtcgtaaagacg
agtaagtcgtatccattgccatcgaatggatttgagagcacgtatgcctctaaagagcat
gagctaggcgattctcgtgtgcagtccagcgagtgtagcagcctgtttaaggaaacggag
gctccggtcccagagcagcaatgcgaagctatgcctttgccagtggtgaatgtagatcac
tctaaaactttaatcaagaagctggatgatcaggcgactccatgcgacaaaaccaaagaa
tcagttttttgctacatttccgatgatgccaccccttctttgtaccattcggaggttgaa
atcgaagcagaaccagcagatctgaaagttacttctgaggcgtttctggacgtgcacgtc
gaaccacagacggtgacgtgcgactatgaaagcccagaggatcaaaattccaagtcggcc
tgtgaagacgatcagtatcatatgaaccatgcccataaaacgagcctagctgtggacagc
tcgagcagagattcctcccaggatggctattccccccgaatcaggttggacaatcccatg
gtcgcgcagcatcccgagggcaacgtcccctccaagtgggacagggccccgccaagccaa
tgtgagaggccagcacaccactcggaagctgaggagatgctggaggtggacacccggcat
gtcgaccttccttcggcgaaaggcaagctgtcgttcaaggacgagcattcgtattactcc
gaattgccgccggagcaccgcagcagagaggtcgtggtggaagaaagcgcggtttctacc
gagggacttgggtctgacgacctgaaagagcaaggcctcggcacctcaattgaggacgcc
gggaatgggcccttggtggcgtcggcttttccagacgctttgtttccatcttgcgacgtt
gtggtcaccgccgaagaaactgaaaccctaacgcaggccccgacgtgtgacagcagcggc
ggcgcctccgacttcgttcccgctcgccatgacgattactcggacacggccgaaagcgac
agcgaggcgggcagcgacgacagcgagacggaggattcagattctgacgatggcatgcct
cggaagcggctccagtcggttgtggtcgtccccaagaactccaccatcgccatggaggag
agcagcccgtgctcctcgcggagcagccaaggcaaccggcgctactcggaccactgggac
gatgagaggccggagcccagccggccttactacgaagagaggccggagaatacgacgagt
aagaacggcctgcaggcagagagcaggtgctcccctcggggcatggagaagagcccggcc
tcttccaccgagctcagcaggaaggagcccgaagagcttcgtccagacgcttgccagcct
cagagcgatggcgttgacagcacgagtcaggcagatttagcggcggattctgatggcaaa
cccaaccaggacgagaggctgaaggagctggtgtccgcgggtagacctggtggcctgcag
gaggagcagccattttgtctgcccgagagcttggaaagcgccgataactcccgacaccaa
accaacgcttcccagcccgacagcaggcaggggaagggtgggcttaatcagtctggcctc
ggggagttctccaaggtggacggttttcatacagcggaggatttgggtggtttaggctgg
gatttctcccagccggagaagcccagtagcacctaccagcagccggatagcagcttcggg
gtctactcaggctacgtttaccagccaggttcgggagcctacggcggctctcagaactac
tggcaaggcaacggttattgggacgcgaggtctgctagcaggccttctggaattaattac
gaacggattcaagggcaagtgccggattccctaacggaggatcacgaggagtacgaggag
gatgaccgctgggatgatgagtgcaaggctcgttttcccagctccccgagtaaattccac
gctcctgagcagaaagaggcaggttctgtgcaagcccacgagatcagcagcaattccacc
aaggagccgggctccgccggtgagaaaaaggaggaggtgaaggctttggaaaaaaacgac
gtgaaggagcgagggccgccaaaaaaaaggcgccaggagttggagagtgactcggagagc
gatggcgactcgagggagaggaagaaggtaaaggcagagggggagcaagcggaggcggca
ccgcaggactcctccatggtcggtcgcttgtgcatcatggatgactttagagacccgcag
cgctggaaggagtttgccaagcaaggcaaaatgccctgttactttgacctgattgaggaa
aacgtgtacttgacggaaaggaagaagaacaaatctcaccgggacatcaagaggatgctg
tgcgagtgccctcctctctccaaagaggaacgagctcagggggaggtcgcttgtggagaa
gactgtctcaaccgcctgctcatgatcgagtgttcttccaggtgcccaaacggcgactac
tgttccaacaggcgcttccagaagaaacagcatgcagatgttgaagtgatcctcactgag
aagaaaggttggggactcagagctgccaaagatctcccatcgaacacctttgtgctggag
tactgcggggaagtgctggaccacaaagaattcaaggcgcgtgtgaaggagtatgcccgc
aacaagaacatccactattacttcatggccctaaaaaacgacgagataatagacgctacc
cagaaaggaaactgctcccgttttatgaaccacagctgtgaaccaaactgtgagacacaa
aagtggactgtgaatgggcagctcagagttggatttttcaccaccaaactcgtcccgtcg
ggttcggagctgacgtttgactaccagttccagagatacggcaaagaagctcagaaatgc
ttctgcggctcggccaactgccggggttacctggggggagagaacagggtcagcatccga
gcggctggagggaagatgaaaaaggaacgctcccggaagaaggattcggtggacggggag
ctggaagccctgctggagaacggcgaggggctctcggataagaaccaagttctcagcctg
tcccggctgatggtgcgcatcgaaacgctggagcagaagctcacctgcctcaagctcata
cagaacacgcactcgcagtcgtgcctgaagtccttcctggagtgccacgggctttccctc
ctctggatttggatgacggagctgggcgacggccgggggagcaccgccaacaacctgaag
ctgcagctggagatcatgaagacgctggagctgctgcctatccccaccaagaacatgctg
gaggagagcaaggtgctccccatcattcaacgctgggctcagaccaagacagctgtcccg
cagctcagcgagggcgacggctactccagcgagaacacgtcacgggctcacacaccgctc
aacacgcccgatctttccgccaagcagagcgtggaaggggacacggatacccccaaaaag
ctggtgtttcggaggctcaaaattataagtgagaacagcatggacagcgccatctcggat
acaaccagcgagctggaggggaaggaagggaaggaggacctggaccagctggagggagcc
ccgacggaggcgtcggaggagcagcagcaacagcaggagatgaaacccgctggtgacgtg
ccggtggagagcagcaaaccccaagttgtggagctggaggccgagcctgaagtggaggtg
aaggagagcaacggggcgaagctggaggagcccatcacgatggagacgccgtcgcaggac
gaagaggagggcgtatccgacgtggagagcgagaggagccaggagcaaaccgacaaaatc
gtcgacgtgagcgacttggccaccaggctgctcgacagctggaaagacctgaaggaggtg
taccgaatcccgaagaagagccaagcagaaaaggagagcagcgccgaccgtgggagagag
gcgtctggccacagggatcagactcccaccccgaaaaaccccgtcctgagccgggagcgg
gatcccgagcggcagagccagagcaaggagaagaagaggcgcagggactcgctgtcgccg
ccgtcctcggcgtacgagcgcggcaccaagaggccggaggacagagcagattgccaaaat
tacggggtttgggactcgagccagcaggctgtggccgtacagcagcaatattcgcccgcc
cagtcgcagccagccatatattaccaggggcagacctgtcagactgtttatggggtgacg
tccccctactcgcagaccaccccgccgattgtacagagttacgcacagcccggcctgcag
tacatccaggggcagcagatctacacggctcacccccagggggtcatcgtgcagcccccc
accgccgtcaccaccatcgtggcagccgggcagccccagcccatccagcagccagagctc
gtggtgagcaataacctcctggacttgcctccgccgtcccctccgaaacccaaaaccatc
gtcctgccgcccaactggaaaacagcccgggatcccgaggggaagatctactactaccac
gtcgtaacgaggcagacccagtgggaccccccgacgtgggacagcccgggggatgacgcc
agcctcgaacacgaagccgagatggacctggggactcccacgtacgacgaaaaccccatg
aagtcttccaagaagcccaagacagccgaggcagacacgtcgagcgagctggctaagaag
agcaaggaagtcttcaggaaagaaatgtcccagttcatcgtgcagtgcctcaacccctac
cgcaaacccgactgcaaggtgggccggataaccacgacggaggacttcaagcacctggca
cgcaagctgacgcacggcgtcatgaacaaggagctgaagtactgcaagaacccggaggac
ctggagtgcaacgagaatgtgaaacacaaaacgaaggagtacattaagaaatacatgcag
aaattcggggccatttacaaacccaaagaggacacggacttggagtaa

DBGET integrated database retrieval system